KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM175060Help
Entry
Phum_PHUM175060   CDS       T01223                                 

Definition
(RefSeq) DNA ligase, putative
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu03030  DNA replication
phu03410  Base excision repair
phu03420  Nucleotide excision repair
phu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:phu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Phum_PHUM175060
   03410 Base excision repair
    Phum_PHUM175060
   03420 Nucleotide excision repair
    Phum_PHUM175060
   03430 Mismatch repair
    Phum_PHUM175060
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:phu03032]
    Phum_PHUM175060
   03400 DNA repair and recombination proteins [BR:phu03400]
    Phum_PHUM175060
Enzymes [BR:phu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Phum_PHUM175060
    6.5.1.6  DNA ligase (ATP or NAD+)
     Phum_PHUM175060
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Phum_PHUM175060
DNA replication proteins [BR:phu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Phum_PHUM175060
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Phum_PHUM175060
DNA repair and recombination proteins [BR:phu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Phum_PHUM175060
   NER (nucleotide excision repair)
    Other NER factors
     Phum_PHUM175060
   MMR (mismatch exicision repair)
    Other MMR factors
     Phum_PHUM175060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 8236783
NCBI-ProteinID: XP_002425128
VectorBase: PHUM175060
UniProt: E0VG84
LinkDB All DBs
AA seq 786 aa AA seqDB search
MGETTITPNQEYKIVSNTKSYDIISKFFLISSADENSPIKATGSKKRLRISSSSSDKDSE
TDDLETTEKKSVDSRIKKTSQKVAKLTTSSKVNPLQSSDNSITDKKDNLDKKNCTNIEKS
NNITSESKTEKVEKTNKKDSSPVKEKVSKCNVLVEDYNPTLPKYHPIKNACWEYGEKVPY
YALTKTFEEIEKVSARLKMIEILSNFLRSVIVLTPDDLLPCIYLSLNKLGPAHEGLELGL
AEQTLIRVISQSTGRTEVGDLGLVAEKSRTSQKLMFKPSPLNVNGVFKKFTEIANLTGKD
SVNKKISMVSNLFTACKGPEAKFLMRSLNGKLRIACATTPPGQKYPPKNLDVSSTMSPDT
FKSHVDELALILKTTYCECPNYGMLVPVLLKEGISALPKHCKITPGLPMKPMLAQPTKGV
QEVLTRFEDMEFTCEWKYDGERAQIHYLENGKVKIFSRNQEDNTSKYPDIISRIQQVKKD
SVTSFILDCEAVAWDKENNAILPFQVLIKRKRKDVAESDIKVPVCVYMFDLLYLNGKPLV
KEKFIDRRRLLQENFNEVLGEWTFAKSIDTTKMEEVQEFLEESIKGNCEGLMVKTLREEA
TYEIAKRSKNWLKLKKDYLEGVGDTLDLVVLGGYLGKGKRTGTYGGFLIGCYDNDNEEYQ
SICKLGTGFSDESLAQHTEFFKPHVITQAPSYYQYDTSMEPDHWFEPIQVWETKCADFSL
SPIHRAAVGVVDPVKGISLRFPRFLRIRDDKKPEDATTAQQIIDLYHNQEQVKCQNSVKF
QEEDFY
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaactacaattactcctaaccaagaatataaaatcgtcagcaataccaaatca
tatgatataatttcaaaatttttcttaattagttctgcagatgaaaattccccaattaaa
gctacaggtagtaaaaaaagacttaggatttcaagttctagtagtgataaagattctgaa
actgatgatttagaaaccactgaaaaaaaatctgtagattctagaatcaagaaaactagt
caaaaagttgccaaattaacaacttctagtaaggtaaatccactacaatcatcagataat
tctataacagataaaaaagacaacttagacaaaaaaaattgtacaaacatagaaaaaagt
aataatattacttctgaaagtaaaacagaaaaagtggaaaagacgaataaaaaagattct
tctccagttaaagagaaagtcagcaaatgtaatgtattagtcgaagattataatccaact
ttacccaagtatcatcctatcaaaaatgcttgctgggaatatggtgaaaaagtgccttat
tatgctttgactaaaacatttgaagaaattgaaaaagtatctgccagattaaaaatgata
gaaatattatcaaattttttaagatctgtaattgtattaacacctgatgatttattacca
tgcatatatctcagcttgaataaacttgggccagctcatgaaggtttggaattaggtttg
gctgagcaaacattgattcgggtaatctcacaaagcacaggaagaactgaagttggagat
ttgggattggtagcagaaaaaagtagaacatcccaaaaattaatgtttaaaccatctccc
ttgaatgtaaatggtgtttttaaaaaatttacagagatagctaatctaactgggaaagat
tctgtaaataaaaaaatatctatggttagtaacttattcacagcttgcaaaggacctgaa
gcaaaatttttaatgagatctttaaatggaaaactcagaattgcatgtgctacaactcca
cccggacaaaaatatccgccgaaaaatttagatgtaagttccacaatgtctcccgatacg
tttaaatctcacgttgatgaattggcgttaatattaaaaacgacgtattgcgaatgcccg
aactatggaatgttagtacctgtgttattaaaggaaggaatatccgctttgccaaaacat
tgtaaaatcactcccggcttacccatgaaaccaatgttggctcaaccaacaaaaggagtt
caagaggttttgacaaggtttgaagatatggagtttacgtgcgaatggaaatacgatggt
gaaagagcacagattcattacttggaaaatggaaaagttaaaatttttagtaggaatcaa
gaagacaatacgtcaaaatatcctgacatcatatccagaatacaacaagtaaaaaaagac
agcgtgacatcttttatattagactgcgaagccgtggcttgggacaaagaaaacaatgcg
attttaccatttcaagttttgattaaacgtaagagaaaagacgtggcagaatcggatatc
aaagtacccgtttgcgtttacatgtttgatcttctttacctaaatggaaaaccgttggtg
aaagaaaaatttatcgatcgacgtcgtttgttacaagaaaatttcaatgaagttttgggc
gaatggacgtttgccaaatcgatagacactactaaaatggaagaagtacaagaattttta
gaagaatcgatcaaagggaattgcgagggtttgatggtgaaaacattaagagaagaagca
acgtatgaaattgcaaaaagatctaaaaattggttgaaactcaaaaaggattatctcgaa
ggagtcggcgatactttggatttggtcgttttgggtggttatctgggcaaaggtaaaaga
acgggtacatatggcggttttctcatcggttgttacgataacgataacgaagaatatcaa
agtatttgcaagctcggcaccggattttccgacgaatctttagctcaacacacggaattt
ttcaaacctcacgtcataactcaggctccatcgtattatcaatacgatacgtcaatggaa
cctgatcattggttcgaacccattcaagtgtgggaaactaaatgcgctgatttttcatta
tcgcccattcatcgagctgcagtcggagttgtagatcccgtgaaaggtatttcgctgaga
tttcccagatttctcagaataagagatgataaaaaaccggaagatgcaacgacggctcag
caaataatcgatttgtatcacaatcaagaacaagttaaatgtcaaaattcagtgaaattt
caagaagaagatttttattaa

DBGET integrated database retrieval system