KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM183580Help
Entry
Phum_PHUM183580   CDS       T01223                                 

Definition
(RefSeq) hypothetical protein
  KO
K09540  translocation protein SEC63
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu03060  Protein export
phu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:phu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Phum_PHUM183580
   04141 Protein processing in endoplasmic reticulum
    Phum_PHUM183580
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:phu03110]
    Phum_PHUM183580
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:phu02044]
    Phum_PHUM183580
Chaperones and folding catalysts [BR:phu03110]
 Heat shock proteins
  HSP40 / DNAJ
   Phum_PHUM183580
Secretion system [BR:phu02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   Phum_PHUM183580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec63 DnaJ FliG_N
Motif
Other DBs
NCBI-GeneID: 8240011
NCBI-ProteinID: XP_002425227
VectorBase: PHUM183580
UniProt: E0VGI3
LinkDB All DBs
AA seq 753 aa AA seqDB search
MGGQKFQYDESGGTFFYFLLSFLALLLIPGTYYWWPRKEKEDPNEVEKQCKCPLCQRKKI
ILSQDQPWKKTKEYAVKSVIILGWVVLVVLAYRVSQFDYEMANFDPYEILGIPLGASVQQ
VKKAYKQLSLIYHPDKATGNEKMFMKLTKAYQALTDEEAKRNFEKYGNPDGPGAMSFGIA
LPSWIVEKKNSVWVLGLYALVFMVALPTVVGMWWYTSIRYSGDQVLLDTTQMYYYLFHKT
PSMPLKRVIMILGASLEFEKKYNNEIVERPTDDIEVPQLIRQFTYLGEKNKEKPLCYPYS
IKARALLHAHLSRMSLNPLTLDRDRMYIVKKCPYLIQEMVSCVSQLILMAYAKRLKNLIF
IETVENVMKLCPMIVQGLWEFKSPLLQLPHITEDHLKFFFSKKRSIKTIQQLAQLKSDER
RNILKILSDEQYEDVMKVMGKMPYIECKVRCEVIDDEATTVYTAGAIVTVTVNLIRRDMS
TLFGDDSLNEETIDETENKEEKEPQNVVKKPIWQKQNKRSKNVKNKKHTKKTSKSTSGSG
MASKGAGENGSVVNNKVNTDNIKKEKEKEAGDSESGLSDDGDHSDDEDNENDQGDKKDSS
LEDDDVEWERLQTKITKRDKVLEGKSKLSHTVHCPYFPQVKQEYWWVYVSDRKSRTLLTA
PYHVTALVHEETVQLKFTAPKWPGLYTFAVCLRSDSYLGADQMHDIKLDVKEAPEVPIEH
PQWHNVSDIEEGNEGDNFDISEFTTDEDIEDQD
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgggaggacagaaatttcagtatgatgaaagcggaggaacctttttttattttttactc
tcttttcttgctttattgttaattcccggtacatattattggtggccgagaaaagaaaaa
gaagatccaaacgaagtggaaaaacagtgcaaatgtcctctttgtcaacgaaaaaaaata
attttgtcacaagatcaaccatggaaaaaaacaaaagaatatgcagtgaaatctgtaatt
atattagggtgggtagtccttgtagtattggcatacagagtttctcaatttgattatgaa
atggccaattttgatccatatgaaattctcggaattccacttggagcatctgtccagcaa
gttaaaaaagcttataagcagctttcattaatttaccatcctgataaagccacaggaaat
gaaaaaatgtttatgaagttaacaaaagcttatcaggctttaacggatgaagaagccaag
cgaaattttgaaaaatatggtaatccagatggacctggagccatgtcatttggaatagct
cttccatcttggattgtcgaaaaaaagaattctgtttgggttctcggtttatatgcttta
gtatttatggttgctttgcctacagttgtagggatgtggtggtatactagtataagatat
tctggtgatcaagtgttgcttgataccacacaaatgtattattatttatttcataaaacg
cctagtatgcccctaaaaagggttattatgatattaggagctagtttagaatttgaaaaa
aaatataataatgaaatagttgaaagaccaacggatgatatagaagttccacagttaata
aggcagtttacctatttgggtgaaaaaaacaaagaaaaaccgttatgttatccttattct
ataaaggcgagagctttattacatgctcatttatctagaatgtctcttaatcctttaaca
ttagatagggatagaatgtatattgttaaaaaatgtccatatttgattcaggaaatggtg
agctgcgtctctcaattaattttaatggcttacgccaaaagattaaaaaatttaatattt
attgaaaccgtggaaaacgttatgaaactctgtccaatgatagttcaaggtttatgggaa
ttcaaaagtccgttacttcaattacctcacataacggaagatcatcttaaattttttttt
tctaaaaagaggtctataaaaactatacagcaattagcccaattaaaatcggatgaaaga
agaaacattcttaaaattttgtctgacgaacaatatgaagatgttatgaaagttatgggt
aaaatgccttacattgaatgcaaagtgagatgtgaagttatcgacgatgaagcaactact
gtatacacagcaggagctattgtcactgtaacggtaaatttaatacggcgtgatatgagt
actttgtttggtgatgatagtcttaatgaagaaacaatagatgagactgaaaacaaggaa
gaaaaagaaccgcaaaatgttgtgaaaaagcctatttggcaaaagcaaaacaaaaggagt
aaaaatgttaaaaataaaaaacacacgaaaaaaacctccaagtctacttctggttctggt
atggcctcgaaaggcgccggcgaaaacggaagtgttgttaataataaagttaatacagat
aatattaaaaaagaaaaggaaaaagaagcgggtgatagtgaaagcggtcttagcgatgac
ggagatcatagtgatgatgaagataatgaaaatgaccagggtgacaaaaaggattcatct
ttagaagatgatgatgtagaatgggaaagacttcaaaccaaaatcactaaacgtgacaag
gtgctggaagggaaaagcaaattatctcatacagttcattgcccatactttccacaagtg
aaacaagaatattggtgggtgtatgtttcggacagaaagtctagaactttattgacggct
ccctaccatgtcacggccttagttcatgaagaaaccgtgcaattaaaatttacggcccct
aaatggccaggactttacacattcgcagtttgccttcgtagtgattcctacttaggagca
gatcaaatgcatgacattaagctcgacgtgaaagaagctccggaagttcctatcgaacat
cctcaatggcataatgtttcagatattgaagaagggaatgaaggagacaattttgatatt
agtgaatttacaacggacgaagacatcgaagatcaagattaa

DBGET integrated database retrieval system