KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM186980Help
Entry
Phum_PHUM186980   CDS       T01223                                 

Definition
(RefSeq) DNA ligase, putative
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu03410  Base excision repair
Module
phu_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:phu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Phum_PHUM186980
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:phu03400]
    Phum_PHUM186980
Enzymes [BR:phu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Phum_PHUM186980
DNA repair and recombination proteins [BR:phu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     Phum_PHUM186980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C RNA_ligase BRCT
Motif
Other DBs
NCBI-GeneID: 8240034
NCBI-ProteinID: XP_002425250
VectorBase: PHUM186980
UniProt: E0VGK6
LinkDB All DBs
AA seq 927 aa AA seqDB search
MSDKEDEEQPSEKPFHVDRAKTGRAGCKKCKQKISQGELRMAKLAYNPFGTGTIKQWHHI
QCIFDVFKKQRATTKKIEHPDEIGGWDNLNENDQQEIINYFPPELQKIFESASRETLNAT
LQHKDSLNKIIEKKFANHKDNSFKMFRKICVDLANDSSYLTKTKIVADFFNKGSDGESFK
SDYELWCRLLLPGAVIRVYNLQSKQLIKLFSKILGVDHDAMLEDLEKGDVAETISSFFKT
STKIKEANKSTLTLQEVDEFLEKLSKMTKEDEQNYHFKGITKKCTANDLKMIIRLIKHDL
RINAGPKHILEALHKDAYKAFQTSRDIKSVVYNAIKAREKNNNKKNEKLNSEKGMDISIN
MMTPVLPMLAQPCKSVEMALEKCPNGMFSEIKYDGERVQLHKLGDTFKYFSRSLKPVLAH
KVSHFKEYIPQAFPYGKDLILDAEILMVDNNTGKPLPFGTLGIHKKSEFKNANVCLFVFD
CMYYNGQSLLTTCLSERKSILRQNMVEINNHIMFSEMEEINRAEDLEEMITKVFKQGLEG
LVLKDKKSVYEPGKRHWLKVKKDYLCDGAMADSADLVVLGAWFGTGHKGGIMSSFLMGCY
DAKSKKWVTVTKVSSGHDEQTLDRIQKELSVVKISKDPSKVPNWLNCTKTMIPDFVANDP
KKMPVWEITGAEFTCNQVHTANGISIRFPRVTKIRSDKDWASATNLSELKKLFKKSKDTS
NFSLLNTSRSSSSTGGETTGDDGTPKKLKKRKNDDDDEKKTDTTTVKKSRKADENVEAYF
EETDTEEEEEKNPSENSESKEKSFSNPLPNIFTGCVIQIPKEYKNYDLLRRYLIAYDGKL
YDPEKETSVENGKNKVTHVIHLNKVGKIVKNEKYWDKGVRHVHVNWIWNSIKLLDKQPES
CHVVTVEQKSGYRYNFKKCYLLNQKNK
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataaagaggatgaagaacaaccgtcagaaaaaccctttcatgttgatagagct
aaaaccggacgagcaggttgtaaaaaatgtaagcaaaaaatatctcagggcgaattaaga
atggccaaattggcttacaatccttttggaactggaactattaagcagtggcatcatatt
caatgtatttttgatgtttttaaaaaacaaagagccacaactaaaaaaattgaacaccct
gatgaaatcggtggatgggataatttaaatgaaaatgatcaacaagaaattattaattat
tttcctccagaactgcaaaaaatatttgaatctgcttcgagggaaactttaaatgccact
cttcaacacaaagattcattaaataaaattattgaaaaaaaatttgcaaatcacaaagac
aattcttttaaaatgtttaggaaaatttgtgttgatttagctaatgatagtagctatttg
actaaaaccaaaattgtcgctgatttttttaataaaggttctgatggtgaatcatttaaa
agtgattatgagctttggtgcagattactactgcctggtgcagtgattagagtttataat
ttacaaagcaaacaactcattaaattgtttagtaaaattttaggtgtagaccatgatgct
atgcttgaagatttagaaaaaggggatgtagctgaaacaatatcttcattttttaaaact
tcgacaaaaataaaagaagcaaataaatcaactttaactcttcaagaagtcgatgaattt
ttagaaaaattatctaaaatgacaaaggaagatgaacaaaattaccactttaaaggcata
actaaaaaatgtactgctaatgatttaaaaatgattatcaggttgattaagcatgactta
agaattaatgcaggtcccaaacatatattagaagctctacacaaagatgcttataaagca
tttcaaacatcgagagatataaagtcggttgtatataatgcaataaaagcaagggaaaaa
aataataataaaaaaaatgaaaagcttaactcagaaaaaggcatggatataagcataaat
atgatgacccctgttcttcccatgttggctcaaccttgtaaatctgtagaaatggcacta
gaaaaatgtcctaacggaatgttttcggagataaaatatgatggggagagagttcaattg
cataaactgggagatactttcaaatatttcagtagaagtttaaaacctgttcttgctcat
aaagttagtcattttaaagaatatatacctcaagcttttccctatggaaaagatttaatt
ttagatgctgaaattttaatggtggataacaatacaggcaaacctttaccttttggcaca
ctaggaattcataagaaaagtgaatttaaaaatgctaatgtctgccttttcgtctttgat
tgcatgtactacaatggccagtcacttttgacaacatgtctttcggagagaaaaagcatc
ttacgacaaaatatggtagaaataaataatcacataatgttttcagaaatggaagaaatt
aacagagcagaagatttagaagaaatgatcactaaagtttttaaacaaggtcttgaaggt
ttagttttaaaagataaaaaatctgtgtacgaacctggaaaaaggcactggctcaaagtt
aaaaaagattatctctgtgatggggccatggcagattctgcagatttagttgttttaggg
gcttggtttggaacaggacacaaaggcggtatcatgtcatcatttctaatgggttgctac
gatgcaaaatcaaaaaaatgggttaccgttacaaaagtttccagcggtcacgatgaacaa
acgttggacaggattcaaaaggaattaagcgtcgtcaaaataagcaaagatccttctaaa
gttcctaattggttaaattgtacgaaaaccatgatccccgatttcgttgccaacgatccg
aaaaaaatgcccgtgtgggaaatcaccggagcagaatttacctgcaatcaagttcatact
gctaacggtatctccataagatttccaagggtaaccaaaatcagaagcgataaagattgg
gcttcggccacgaatttaagcgaattaaaaaaattatttaaaaaatctaaggatacttca
aacttttcgttgctcaacaccagtcgaagttcttcctctaccggtggagaaacaaccgga
gacgatggaacgcctaaaaaattaaaaaaaagaaaaaacgacgacgatgatgagaaaaaa
actgatacgactacggttaaaaaatcgaggaaagcagacgaaaacgtcgaggcttatttt
gaagaaaccgacacggaggaagaagaagaaaaaaatccttcggaaaattcggaatcgaaa
gaaaaatcgttttcgaatccgttaccaaacatttttaccggatgcgtgatacaaatccca
aaagaatataaaaattatgatttgttgagaaggtatttgatagcatacgatggaaaatta
tacgatccggaaaaagaaacgtcggttgaaaatggaaagaacaaagtaactcacgtcatt
cacttgaacaaagtgggaaaaattgtaaaaaatgaaaaatattgggataaaggggttcga
cacgttcacgttaactggatttggaattccattaaattattagataaacaaccggaatct
tgtcacgtcgtaacggtcgaacaaaaaagtggatatagatacaatttcaaaaaatgttat
ttgttaaatcaaaaaaataaatga

DBGET integrated database retrieval system