KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM235980Help
Entry
Phum_PHUM235980   CDS       T01223                                 

Definition
(RefSeq) glycogen synthase, putative
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00500  Starch and sucrose metabolism
phu01100  Metabolic pathways
Module
phu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Phum_PHUM235980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:phu01003]
    Phum_PHUM235980
Enzymes [BR:phu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Phum_PHUM235980
Glycosyltransferases [BR:phu01003]
 Polysaccharide
  Storage polysaccharide
   Phum_PHUM235980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 8230217
NCBI-ProteinID: XP_002426088
VectorBase: PHUM235980
UniProt: E0VIZ4
LinkDB All DBs
AA seq 704 aa AA seqDB search
MFKERASRRFYRVDSSHDFGSIMDHGQTASFQNRWTFEAAWEVCNKVGGIYTVIRSKAFV
STEEMGDQYVLLGPYKERSARTEVEETEFPMNQPLNQAVNNLREMGYKIVTGTWLVDGNP
QVILFDIGSGAWKLDEFKQELWEKSNLGIPHPDIEANDAVIFGFMVCEFLTEFQKLAEKH
HDQPPRIVAHFHEWQAGIGLIALRIRQVELATVFTTHATLLGRYLCAGNTDFYNNLDKFN
VDEEAGRRQIYHRYCVERAATHLANIFTTVSEITGLEAEHLLKRKPDIITPNGLNIKKFS
ALHEFQNLHAIAKEKIHEFVRGHFYGHYNFDLDKTLYFFIAGRYEFGNKGADIFIESLAR
LNHYLKSNHSDTTIVAFLIFPAPTQNFNVESLRGHAVTKSLRDTLQLIQNKIGKRMYEIC
LRGRMPDANELLLKEDQVKIKSCIYALQRDGLPPVTTHNVIDDYKDPVLNALRRCRLFNT
IHDRVKVVFHPEFLSSTNPLFGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSIT
TNLSGFGCFMQEQIEDPMSYGIYIVDRRHISLESSVQQLAQFMYDFSRLNRRQRIIQRNR
TERLSDLLDWRNLGIYYRQARVRALQAVFTDITFEEEESKGKRFNYPRPISEPPSPSSSR
HSSVHGSDNEEDEEDEVDDEKELQELGVNAKETQEMKMSQKTVS
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagaaagagcatcgaggagattttatagagtggatagttcccatgattttggc
agtattatggatcatggtcaaactgctagttttcaaaatagatggacttttgaagctgcc
tgggaagtgtgcaataaagttggaggaatatatacagttatcagatcgaaagctttcgta
tcaactgaagaaatgggtgatcagtatgttttactcggcccatacaaagaaagaagtgct
agaactgaagtagaagaaactgaatttccaatgaatcaacctttaaatcaggcagttaat
aatttaagagaaatgggttataagattgttaccggtacatggcttgtcgatggaaaccct
caagttattctgtttgatattggatctggagcttggaaattggatgagtttaaacaagaa
ctgtgggaaaaatcaaatttaggtatacctcatccagatatcgaagctaatgatgctgtt
atttttgggttcatggtttgtgagttccttacagagtttcaaaaattagctgaaaaacat
catgatcaaccaccgcgtatagtcgctcattttcacgaatggcaagctggaataggactt
atcgctttgagaattagacaggtcgaattggcgacagtttttacaacgcatgcaacactt
ttaggtcgttatttgtgcgctggtaatacggatttttacaataatttggataagtttaat
gtcgatgaagaagcaggacggaggcaaatttatcataggtattgcgtcgaaagagcagca
actcatttagcaaatatatttacgacagtttccgaaataacaggtttggaagctgaacat
ttactcaagagaaaaccagacataatcactccgaacggtttaaatataaaaaaattttcc
gcattgcacgaatttcaaaatcttcacgccatcgcaaaggaaaaaattcacgaattcgta
cgcggtcatttttacggtcactacaatttcgatctcgataaaactttgtattttttcatc
gcgggaaggtacgaatttggtaacaaaggtgctgatatttttatagaatctctagctaga
ttaaatcattatttgaagagcaaccattcggatacgacgatagtagcttttcttatattt
cctgcgccaactcaaaatttcaacgtcgaaagtcttcgaggtcacgcggtaactaaaagt
ttaagagacacgttgcaattaattcaaaataaaattggaaagagaatgtacgaaatatgt
ttaagaggtcgaatgcctgacgccaacgaacttttattaaaagaagatcaagtgaaaata
aaatcttgtatttatgccttacaaagagatggtcttcctcccgtgacgacacacaacgtc
atcgatgattacaaggatcccgttttgaatgcgttgagaagatgtcgtttgtttaacaca
atacacgatcgcgttaaagttgtttttcatccagaatttttgtcgtcgacaaatccattg
tttgggttggactatgaagaatttgtgcgtggatgtcatcttggagtgtttccgagttat
tacgaaccctggggctacacgcctgccgaatgtactgttatgggaataccgagtataaca
actaacttatccggatttggttgttttatgcaagagcagattgaagatcccatgagttat
ggtatttacatcgttgacagacgtcacatatcactggaaagttccgttcaacagttggca
caatttatgtatgatttttcaagattaaacaggaggcaaagaataatccagagaaacaga
accgaacgattgagcgatttgttagactggagaaatttaggaatttattatcgacaagct
agagttcgagcattgcaagctgtttttacagacattactttcgaagaagaggaaagtaaa
ggaaagagatttaattatccaagacccatatcggaaccgccaagtccatctagtagcagg
cacagttccgtacacggttcggataacgaagaagatgaagaagatgaagtcgatgacgaa
aaggagttacaagaacttggagtaaacgcaaaagaaactcaagaaatgaaaatgagccaa
aagactgtatcatga

DBGET integrated database retrieval system