KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM320310Help
Entry
Phum_PHUM320310   CDS       T01223                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, putative
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00250  Alanine, aspartate and glutamate metabolism
phu00280  Valine, leucine and isoleucine degradation
phu00410  beta-Alanine metabolism
phu00640  Propanoate metabolism
phu00650  Butanoate metabolism
phu01100  Metabolic pathways
Module
phu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Phum_PHUM320310
   00650 Butanoate metabolism
    Phum_PHUM320310
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Phum_PHUM320310
   00280 Valine, leucine and isoleucine degradation
    Phum_PHUM320310
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Phum_PHUM320310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:phu01007]
    Phum_PHUM320310
Enzymes [BR:phu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Phum_PHUM320310
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Phum_PHUM320310
Amino acid related enzymes [BR:phu01007]
 Aminotransferase (transaminase)
  Class III
   Phum_PHUM320310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 8236105
NCBI-ProteinID: XP_002427468
VectorBase: PHUM320310
UniProt: E0VMX4
LinkDB All DBs
AA seq 479 aa AA seqDB search
MNVSGAYLRHYTGVPGEAKGPSVKTSIIPGPASQKLLESLNEVQQCNSVQLFADYNKSLG
NYLVDVDGNILLDVYTQISSVPIGYNHPELLKSMEKLENIKVMINRPALGVFPGADWPEK
LKQVLIGVAPKGLDHVTTMSCGSCSNENAYKQIFIWYRKNQRGENITFSEQEKTSCMINL
PPGAPQLSMLSFKGAFHGRTLGVLSTTHSKYIHKIDIPAFDWPIANFPKYKYPLEENERE
NAEEDEKCLAQVEDLIVKYEKKGIPVAGIVSEPIQAEGGDNEASPYFFQKLQRIGKKYGA
ALLIDEVQTGGGPTGKMWCHEHFNLDSPPDVVTFSKKMFLGGFFHSKELKPDQPYRIFNT
WMGDPSKLLLLETVINVIKRDNLLSLVQKSGDILLSELKKLQNEYSHLINSARGRGTFLA
ISCSSPQIRDKLVAKLKMEGVQAGGCGDQSIRLRPALIFAPQHAYIFLDKFRTALKETK
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtttcaggggcgtacttaagacattatactggagttccaggagaggctaaggga
ccgtcggttaaaacttcaattattccaggacctgcttcacaaaaattattagaatctctt
aatgaagttcaacaatgcaattccgtacagttatttgcagattataacaaatcccttgga
aactatttggttgatgtggatggaaatattttattagatgtatacactcaaatatcatcc
gttcccataggatacaatcatccggaattattgaaaagcatggaaaaacttgaaaatata
aaagtcatgatcaatagaccagctttgggcgtcttccccggtgcggattggccggaaaaa
ttaaaacaagtattaatcggtgtagcgccaaaaggactggatcatgtcaccaccatgtcg
tgtggatcttgttctaatgaaaatgcatacaaacaaattttcatttggtatagaaaaaat
caaagaggagaaaatattaccttttctgaacaggagaaaacatcttgcatgataaattta
ccaccgggagctcctcaactttctatgctgtcctttaaaggagcttttcacggccgaaca
ttgggagtactatccacgactcactccaaatacattcataaaatagatattcccgctttt
gactggcccattgctaattttccaaaatataaatatccattggaagaaaatgaaagagaa
aatgccgaagaagatgagaaatgtttagcccaagttgaagatttaattgttaaatatgaa
aaaaaaggaattcccgtcgctggaattgtaagcgaaccgattcaagcagaaggaggtgat
aacgaagcatctccatatttttttcaaaaacttcaaagaatcggtaaaaaatatggagcg
gctttattgattgatgaagtacaaacaggaggaggtccaactggtaaaatgtggtgtcac
gaacatttcaatttagattctccacccgacgttgtgacattcagtaaaaaaatgttttta
ggaggtttttttcacagcaaagaactcaaacctgatcaaccgtacagaatatttaacact
tggatgggtgatcccagtaaattacttcttttagaaaccgttattaacgtcatcaaaaga
gacaatcttctttctctcgttcaaaaatctggagacatattactttcggaattaaaaaaa
cttcaaaatgaatattcgcatttaataaattctgctcgaggacgtggtacgtttttggca
atttcatgctcttctcctcagatcagggataaattggtggccaaattaaaaatggaagga
gttcaagctggaggctgcggagatcaatctataagacttagaccggcgttaatttttgca
cctcagcatgcctacatatttttagataagtttagaacggctttaaaagaaacaaagtaa

DBGET integrated database retrieval system