KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM363910Help
Entry
Phum_PHUM363910   CDS       T01223                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, putative
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Phum_PHUM363910
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Phum_PHUM363910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 FAD_binding_2 FAD_oxidored GIDA EF-hand_9 NAD_binding_8 Pyr_redox_2 HI0933_like
Motif
Other DBs
NCBI-GeneID: 8233439
NCBI-ProteinID: XP_002428118
VectorBase: PHUM363910
UniProt: E0VPS4
LinkDB All DBs
AA seq 740 aa AA seqDB search
MGIRFRKFVLTGIAVGAGAYLTTSYLLENQNFHIKNVSAEEVVDARQMYRRVKRSLPHRS
EQIKSLQNDSFDVLIIGGGATGSGCALDAVSRGLKTALIEADDFASGTSSRSTKLIHGGV
RYLQKAIMNFDVEQYNMVKEALRERSNMLEIAPHLTRPLPIMLPVYKWWQVPYYWFGIKM
YDFVAGSKTVKSSYYLSKETAIELFPMLKKDKLCGAIVYYDGQQDDARMCLSLALTATRY
GATVANHVKCIDLLKNKTESGKEVICGVRARDELTKEEWDIPAKCVINATGPFTDTIREM
DDPQARKICSPSSGVHVILPGYYSPEQMGLLDPSTSDGRVIFFLPWMKGTIAGTTDLPCE
ITHSPKPTEDEIQFILSEVKHYLNPDVEVRRGDVLSAWSGIRPLVSDPNKPDTQSLARNH
IVHSSKSNLITIAGGKWTTYRAMAEETIDEAIKVCDLKPKHEDCQTLNLKIEGAHGWTPT
MYIRLVQDFGLETEVAQHLAQSYGDRAFAVAKMASLTGKRWPILGNRIHPEYPYIEAEVR
YGIREYACSAVDMIARRIRLAFLNVQAAMESLPVIVDIMATELKWSEEEKKKQLNQATLF
LQQEMGHSVNRASKEKIPINLSNEEVKMYINRFEIIDKDKKGYVSINDLRRSLKRSGENI
SGDELHEILNEIDTNMNGQIELDEYLQMMSAIKSGAVSHSRFAKVAEMEEEHHKKEMLKK
KISVERSGAQKKKKIQFAIN
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcagatttcgtaaatttgtgcttaccggcattgccgtgggtgcgggagcttac
ttaacgacgtcctacttgttagaaaatcaaaattttcacattaaaaacgtttcggcagag
gaagtcgtagatgccaggcaaatgtatagacgagtcaaaaggtcgctccctcatcgttcc
gaacaaattaaatcccttcaaaatgattctttcgatgttctcatcattggcggaggtgcg
acgggatcaggttgtgcgttggatgcagtttcaagaggtttgaaaacggctttgattgaa
gccgatgattttgcatcgggtaccagtagtcgaagtacgaaacttatccacggtggagtt
aggtatttgcaaaaagccataatgaactttgacgtcgaacaatataacatggtaaaagaa
gctttgcgagaacgatcgaacatgctcgaaattgctcctcatttaacgcggcctttgccc
atcatgcttcccgtttataagtggtggcaagttccgtactattggttcggaataaaaatg
tatgattttgttgccggatcaaaaacggtcaagagttcttattatttgtcaaaagaaaca
gccattgaattatttccaatgttgaaaaaggataaattgtgcggagcgattgtgtactac
gacgggcaacaagacgatgccagaatgtgcttatcactcgctctgactgcaacgagatac
ggagcaacagttgccaaccatgtaaaatgcattgacctgcttaaaaataaaacggaatcg
ggtaaagaggtaatatgtggagttcgagcaagagacgaacttacgaaagaagaatgggat
attccggctaaatgtgtcataaatgcgactggaccttttacggatacgatcagagaaatg
gatgaccctcaagcccgaaaaatttgttctccgagctctggcgttcacgtgattttgccc
ggttactacagtccagaacaaatgggtttattggatccttccacttcagatggtagagta
attttttttttaccgtggatgaaaggaacgatcgcgggaaccacggatttaccgtgtgaa
ataacgcatagtccaaaacctacagaagacgaaatacagttcatactatcggaagtaaaa
cactatttaaatccagacgttgaagttagaagaggtgacgttttgtcagcatggagtggc
attcgccctcttgtttcagatcctaataaaccagacactcaatctttggccagaaatcat
attgtacattcaagtaaaagtaacttgatcaccatagctggaggaaaatggacaacttat
agagccatggcggaagaaaccattgacgaagccataaaagtttgtgatttgaaaccaaaa
catgaagattgtcaaacactcaatttaaaaatagaaggagctcacggttggactcccaca
atgtacatacgtttagttcaagatttcggtttagaaacggaagtggctcaacatttagca
caatcatacggcgacagagcatttgcggtggccaaaatggcaagtttaacagggaaaagg
tggcccattttgggaaatagaattcatcccgaatatccttacatcgaagctgaagttagg
tacggaattagagaatatgcttgctctgccgttgacatgatcgctcgaagaatacgatta
gcttttctaaacgttcaagcagctatggaatccctgcccgtgatagtcgacataatggca
acggaattaaaatggagcgaagaagaaaaaaaaaaacaattgaatcaagccacattattt
ttacaacaagaaatgggtcactcggtgaatagagcttccaaagaaaaaataccgataaac
ctgagcaacgaagaagttaaaatgtacataaatcgattcgaaatcattgacaaagacaaa
aaaggctacgtgtcgataaatgaccttcgtcgaagtttaaaacgatcgggagaaaacata
tccggagacgaattacacgaaatattaaatgaaatagatacaaatatgaacggacaaata
gaattggatgaatatttacagatgatgtccgcaattaaatcaggtgcagtatcacattct
agatttgccaaagttgccgaaatggaagaagaacatcataaaaaagaaatgctgaaaaag
aaaatatcagttgaaagaagtggtgcacaaaaaaaaaaaaaaatacaatttgctatcaat
tga

DBGET integrated database retrieval system