KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM375640Help
Entry
Phum_PHUM375640   CDS       T01223                                 

Definition
(RefSeq) tripsin, putative
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Phum_PHUM375640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:phu01002]
    Phum_PHUM375640
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phu04147]
    Phum_PHUM375640
Enzymes [BR:phu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Phum_PHUM375640
Peptidases [BR:phu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Phum_PHUM375640
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Phum_PHUM375640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin CUB Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 8240203
NCBI-ProteinID: XP_002428303
VectorBase: PHUM375640
UniProt: E0VQA9
LinkDB All DBs
AA seq 401 aa AA seqDB search
MAGKMFFFKHIVFLIIFFVKTCYCIFENCDYYQDLQPNKIYHIFSPGYPENYVPGTKCRW
YAVAPVQNKISLQCEVVKIPVSDNCRQDKFAVSLEGRIDLKDVKFYCGEGTLNVTSVGNK
LNVILWSVTNQVGSLFCTVKIIQNESPVKKCICGQRNSVRIVGGVETGVNEYPMMAGLVD
GNLRVLFCGGTIISNFYVVTAAHCVWDRQARSLAVLVGDHDISVGNDTDSAKLYRASSIR
VHPQYDTANQKNDIALVKIKNKISFNMRVGPVCLPFKNIDNTFVGEKVYALGWGATSFGG
PTSNKLLHVPLDVISVKQCRPSYGDLVSKRQICTYGENKDSCQSDSGGPILWTDPSTGAL
NLLGLVSYGIQCGTTHPSVNTRVSSYLKWIQTATGEEYCVL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcagggaaaatgtttttttttaaacatatagtatttcttataatttttttcgttaaa
acatgttattgtatttttgaaaattgtgattattatcaagatttacaaccgaataaaatt
tatcatattttttcacctggttatcccgaaaattatgtaccaggtacgaaatgccgatgg
tatgcagttgctcctgttcaaaataaaatttctcttcaatgtgaagttgttaaaattccc
gtcagtgataactgcagacaggataaatttgctgtgtctcttgaaggaagaatcgatttg
aaagatgttaaattttactgtggggaaggaacattaaacgttacctcggttggaaataaa
ttaaacgttatcctttggtctgtaactaaccaagtggggtcacttttttgtaccgtaaaa
ataattcaaaacgagtcaccagttaaaaaatgtatttgtggtcaaagaaattcggttaga
atagtcggaggagttgaaacaggagtaaatgaatacccgatgatggccggtttagtagat
ggtaatttaagagttttgttttgtggtggaacaattatatctaatttttacgtagtgaca
gcagctcattgtgtttgggacaggcaagctcgaagtttagccgtattggttggggatcat
gatatctcagtagggaatgatacggacagtgccaaactttatcgtgcttcttcgataagg
gttcatccacaatacgacacggcaaatcagaaaaacgatatagctttagtaaaaattaaa
aataaaatttcttttaacatgcgagtaggtccagtatgcctaccatttaaaaatatcgat
aatacatttgtgggggaaaaagtgtatgctttaggttggggagcaacaagttttggagga
ccgacttcaaacaaattacttcacgttcctttagatgtcatttccgtaaaacaatgcagg
ccttcgtacggtgatttggtatcgaaacgacaaatttgtacttatggagaaaacaaagat
tcttgtcagagtgattctggtggcccaattttatggaccgatccaagtacgggtgcatta
aaccttttgggtttagtaagttacgggattcaatgtgggacaacacatccgagcgttaat
acaagagtttcatcttatttaaaatggattcaaacagcaacaggagaagaatattgcgtt
ctttaa

DBGET integrated database retrieval system