KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM399860Help
Entry
Phum_PHUM399860   CDS       T01223                                 

Definition
(RefSeq) cAMP-response element binding protein, putative
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
KEGG Orthology (KO) [BR:phu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phu03000]
    Phum_PHUM399860
Transcription factors [BR:phu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    Phum_PHUM399860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LptF_LptG ZapB SID-1_RNA_chan
Motif
Other DBs
NCBI-GeneID: 8237935
NCBI-ProteinID: XP_002428758
VectorBase: PHUM399860
UniProt: E0VRL4
LinkDB All DBs
AA seq 659 aa AA seqDB search
MSVSTDISLMDILFDRDDPVLKFAEDKDVFKQEFDVLDSKSDLLCEKLEPWVSDADELLK
DILNDEHFNLLDRDPEDSELNCFDTTLSDWKPITNDEYGIKEVVVGSSSSAYSDSGLSSD
QVSPGLPIDYDFTPNQLDDDEDADDDGHISSAVSTISDASATLLSASDIKIEPQEINSSS
LLEDEMAVLGILPSETHQVEIEKKKIQQITNLSSSVVTTNPRSILLPVNTGNGIKTYKIV
NSSNGCKTFKAVKQLEKAKPVVLKTVRPTGMPLVLKNVKNQSAQKKIKSRSIKYVAEETD
EEEEITVLSDSEDDKVKSQYPRLILSPEEKKLIQKEGVRLPSHYPLTKFEERELKRIRRK
IRNKISAQDSRKRKKEYLDGLEDRVKQCTEENLSLIKKIKLLQSQNQSLMTQVKKLQLTL
AKTTTKTAQPATCLMVIMLSVALIMAPNLRITQNNENDIGDQEVSDKTLQPVAGRTRSLL
SKSTSQDSVNEEDGKISQEMQSDRSTSVHTNSPYSYMHMELSSRNNYILKSDRSRKSSIG
SSSSGYDSPPHFLVDHDYDPPPAKKNRFHFSENEETEEEMLRKKFILPPVDDIWPEPSSV
EKVGTKPKEFIIPDIDDEWVPKQSVLADKIESLTTEVKVNISDSKGTRTVVIHVPKEQE
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtttctactgacataagtttaatggatatccttttcgacagggatgatcctgtt
ttgaaatttgccgaagacaaagatgttttcaagcaagaatttgatgttctcgattcaaaa
tcagatttactttgtgaaaagcttgagccatgggtgtcagatgctgatgaactcctgaaa
gatattttaaatgatgaacattttaacttgcttgatagagatccagaagatagcgaatta
aattgttttgacacgactttgtccgattggaaaccgataacaaacgatgaatatggtatt
aaagaagttgtcgtcggatcttcttcaagtgcctattcagatagtgggctctctagcgat
caagtttccccaggattaccaattgattatgatttcacacctaaccaattggatgatgat
gaagatgcggatgatgatgggcacatatcttcagccgtttcgactatcagcgatgcttcg
gcaactttactttctgcaagcgacataaaaatagaacctcaagaaattaattcatcatcc
ctgcttgaagatgaaatggcagttttgggaattcttccatccgaaactcatcaagttgaa
atagaaaaaaaaaaaattcagcaaataacaaatttatcatcatcagttgtaacaacaaat
cccagatccatacttcttccggttaacactggaaatggaattaaaacatacaaaatagtg
aacagttcaaatggttgtaaaacattcaaagctgtcaagcaattggaaaaggctaaacct
gtcgttttaaaaactgtcagacctacaggaatgccgttggtattgaaaaatgttaaaaat
caaagtgcccagaaaaaaattaaaagtagatcgattaaatatgtagcagaagaaacggat
gaagaagaggaaataacagttttgtccgattctgaagatgacaaagttaaatctcaatat
ccgagattgattttatcaccggaggagaaaaaattaattcaaaaagaaggagttcgtttg
ccttcgcattatccattgacaaaatttgaagaaagggaattgaaaaggattcgaaggaaa
attagaaataaaatatcagctcaagattcgagaaaaagaaaaaaagaatatttagacgga
ttggaagatagagttaagcaatgcacagaagaaaatttatccttgataaagaaaataaaa
cttcttcaatctcaaaatcaatcacttatgacgcaagttaaaaaattgcaactcacgttg
gctaaaacgacaacgaaaacagctcaaccggccacttgcctgatggtgatcatgttgtcg
gttgctcttataatggctccaaatctgagaataacacaaaataacgaaaatgatattgga
gatcaagaagtgtcagacaaaacgttgcaacctgttgcaggtcgtactcggagtttgttg
tcgaaaagcacttcgcaagattccgtcaacgaggaagatggtaaaatttcacaagaaatg
caatcggatcgatctacttccgttcatacaaacagtccatattcttacatgcacatggaa
ttatcgtctcgaaacaattacattttaaaatcggatcgttctagaaaatcgtcgatcgga
agttcgtcaagcggttacgatagtccaccacattttttggtcgatcacgattacgatcca
ccgcctgctaaaaagaatcgatttcatttttctgaaaatgaagaaacggaggaagagatg
ttgagaaaaaaattcatacttccgcccgtcgatgatatatggccggaaccatcgtcggtc
gaaaaggtcgggacgaaacctaaagaatttattattccagacatcgatgatgagtgggta
cccaaacaatcggtactcgcggataaaatcgagtcactaacgacggaggttaaggtaaac
atatctgattccaagggcacacgcacggtcgtcattcacgttccgaaagagcaagaataa

DBGET integrated database retrieval system