KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM419880Help
Entry
Phum_PHUM419880   CDS       T01223                                 

Definition
(RefSeq) Hexokinase type, putative
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00010  Glycolysis / Gluconeogenesis
phu00051  Fructose and mannose metabolism
phu00052  Galactose metabolism
phu00500  Starch and sucrose metabolism
phu00520  Amino sugar and nucleotide sugar metabolism
phu01100  Metabolic pathways
phu01200  Carbon metabolism
Module
phu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
phu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Phum_PHUM419880
   00051 Fructose and mannose metabolism
    Phum_PHUM419880
   00052 Galactose metabolism
    Phum_PHUM419880
   00500 Starch and sucrose metabolism
    Phum_PHUM419880
   00520 Amino sugar and nucleotide sugar metabolism
    Phum_PHUM419880
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Phum_PHUM419880
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Phum_PHUM419880
Membrane trafficking [BR:phu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Phum_PHUM419880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 8234467
NCBI-ProteinID: XP_002429088
VectorBase: PHUM419880
UniProt: E0VSJ4
LinkDB All DBs
AA seq 460 aa AA seqDB search
MVRSWPRNPCVNLSKKVKKKCHSLILNNDQLFRVKKLLLDSLKKGLKKETHPEAIIKCFP
TYVQDLPNGKEKGKFLALDLGGTNFRVLIIYLEENHFDMKSKIYPVPEAIMLGTGTQLFD
HIAECLATFTKENNVNTERLPLGFTFSFPLRQKALTTGLLERWTKGFNCSGVIGEDVVRL
LREALQRRHDVQIDVCAILNDTTGTLMSCAWKNQNCRIGLIVGTGSNACYVEKTDEVETF
NGCNKKPYVVVNTEWGAFGDDGCLDFIRTSYDIDLDKNSINPGKQVFEKMISGMYIGELV
RLIIVHFIELGLLFNGNSSEIIEKKWHFLTKYVSEIESEKKGVFDKCQNVLKTVGIGSVT
DEDCANVRYICQCVSRRAAHIVSAGIATLIDKIGQNNITVAVDGSVYRYHPHFHNLMMAK
TSELLVNPAKFDFMLSEDGSGRGAALVAAVAYRVSITILH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggttcgttcttggcctcgaaatccatgcgtgaatctgagtaagaaggtgaaaaaaaaa
tgtcattcattgatattaaataacgatcagttgttcagagttaaaaaattattattggat
tcattgaaaaagggtttgaaaaaagaaactcaccccgaagccatcattaaatgttttcct
acctacgttcaagatcttccaaatggaaaagaaaaaggaaaatttttggcgttggatttg
ggaggaacaaattttagagttttaattatttacttggaagaaaatcatttcgatatgaaa
tcgaaaatatatccagttcccgaagctatcatgttgggtaccggtacacagcttttcgat
cacattgccgagtgtttagccacattcacgaaagaaaacaatgtcaacacggaaaggtta
ccactgggtttcacctttagttttcccctacgtcaaaaagctctcacgaccgggttatta
gaaagatggacgaaaggattcaattgttcgggtgtcatcggtgaggatgttgtcagatta
ctcagggaagctctccagagaagacatgacgttcaaattgatgtttgtgctatcttgaat
gataccacgggtacgttgatgtcttgcgcttggaaaaatcaaaattgcagaatcggtttg
attgtaggtaccggaagtaatgcttgttacgtggaaaaaaccgatgaagtggaaacgttt
aacggatgtaataagaaaccgtatgtggtggtcaatacggaatggggtgcgttcggtgat
gatggatgcctggatttcattcgtacttcatacgatatagatttggataaaaattcaatt
aatcccggtaaacaagtattcgaaaaaatgatatccggtatgtacataggagaactcgtt
cgtttaataatcgtacatttcatagaattgggattgttattcaatggcaacagttctgaa
attattgaaaaaaaatggcattttttaactaaatacgtttcggaaatagaaagtgagaaa
aaaggagttttcgataaatgtcaaaacgtattgaagactgtcggtataggaagtgtcacg
gatgaagattgtgccaatgttcgttatatttgccagtgcgtatctaggagggctgcccac
atagtttcggccggaatcgcgactctcattgataaaatagggcaaaataacataacggtt
gccgttgacggatccgtttatcgataccatccacactttcataatttaatgatggcgaaa
acatcggaacttctcgtaaatccggccaagtttgattttatgctctcggaagatggtagt
gggaggggagccgctttggttgctgccgttgcttatagagtaagtattactattttacat
taa

DBGET integrated database retrieval system