KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM447590Help
Entry
Phum_PHUM447590   CDS       T01223                                 

Definition
(RefSeq) phospholipase C, putative
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00562  Inositol phosphate metabolism
phu01100  Metabolic pathways
phu04070  Phosphatidylinositol signaling system
phu04310  Wnt signaling pathway
phu04745  Phototransduction - fly
phu04933  AGE-RAGE signaling pathway in diabetic complications
Module
phu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Phum_PHUM447590
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Phum_PHUM447590
   04070 Phosphatidylinositol signaling system
    Phum_PHUM447590
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    Phum_PHUM447590
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    Phum_PHUM447590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phu04131]
    Phum_PHUM447590
Enzymes [BR:phu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Phum_PHUM447590
Membrane trafficking [BR:phu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    Phum_PHUM447590
 Endocytosis
  Macropinocytosis
   Phospholipase C
    Phum_PHUM447590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_like PI-PLC-X
Motif
Other DBs
NCBI-GeneID: 8231217
NCBI-ProteinID: XP_002429677
VectorBase: PHUM447590
UniProt: E0VU83
LinkDB All DBs
AA seq 243 aa AA seqDB search
MEDNDRGGSGGGGGGDLWTEEIVKLAYNINQMNLSPTRFLEKAHTRISLMTDKNDKIPVK
NIIKMFAQNKDDKKRVEKALDGAGMPSGKSDGISIQKFTFEDFYNFYKNLTLRTDVEKIF
DEICGTSSKRKFLTAEKFVTFLNKTQRDPRLNEILYPYANPARAKDLIQQYETNKMNAQK
GQLSLDGFLRYLMSEDNPIIASSSFDLSDDMDQPLSHYFINSSHNTYLTERVFFSLYCFA
FVK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggaagacaacgacagagggggtagcggtggtggtggtggtggtgacttgtggacggag
gaaatcgtcaaattggcgtacaacataaatcaaatgaatttatcaccgacgagattttta
gaaaaagctcacacgaggatatcactgatgacggataaaaacgacaagatacccgttaag
aacataatcaaaatgttcgcacagaacaaggacgataagaaaagagtggaaaaagctttg
gacggagccggaatgccctccggtaaaagcgacgggatatcaattcaaaaattcacgttc
gaagatttttacaatttctacaagaatttaacgctgagaacggacgttgaaaaaatattc
gacgaaatttgcggtacatcgtccaaaagaaaatttttaacggcggaaaaattcgtcacg
tttctgaacaagactcaacgagatccgcgactgaacgaaatactctacccgtatgcgaac
ccggcgagagccaaagacctaatacagcaatacgaaacgaacaagatgaacgctcaaaag
ggacaactcagtctcgatggttttcttaggtatttaatgagcgaggataatccgataata
gcatcgtcatcctttgatttatccgacgacatggatcaaccgctttcccattacttcatt
aattcttcgcacaacacttatttaacagagagagttttcttcagtctttattgtttcgct
tttgttaaataa

DBGET integrated database retrieval system