KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM478060Help
Entry
Phum_PHUM478060   CDS       T01223                                 

Definition
(RefSeq) histone H3 methyltransferase, putative
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Phum_PHUM478060
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phu03036]
    Phum_PHUM478060
Enzymes [BR:phu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Phum_PHUM478060
Chromosome and associated proteins [BR:phu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Phum_PHUM478060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 Methyltransf_4
Motif
Other DBs
NCBI-GeneID: 8239419
NCBI-ProteinID: XP_002430422
VectorBase: PHUM478060
UniProt: E0VWC8
LinkDB All DBs
AA seq 1674 aa AA seqDB search
MPFNAIKLVDYLSKMELRLHSPAGAEPVVYTWPLSGGSGSHDGALEIVETIRWVCEDIPE
LKLPLENNILADYDTKSYDSMRSLCDRFNRAIDSIVQLEKGTSLPAARLNKYPSRGLLRH
ILQQVYNQAVTDPEKLNQYEPFSPEVYGETSYDLICQMIDQIEITSDDIFVDLGSGVGQV
VLQMAAATPCKVCFGVEKAEVPSRYAEDMNKNFKKWMGWYGKKYGEYHLIKGDFLKAEHR
EKIVSATIVFVNNFAFGPNVDHSLKERFADLKDGARIVSSKSFCPLNFRITDRNLSDIGT
IMHVSEMSPLKGSVSWTGKPVSYYLHIIDRTKLERYFQRTKNPRARGNNNSSSSNSNNNN
SNNNHNNGGLQDSISNNMLRNSRARRDSSKQTMNSVSSESRDSDEDSNCPLSTVSKNARN
KSTVRRYGPETNRRKSSISEEENNNIQNTSNNNGKFKKGTNKTVQNKKLRKNVKANDKNL
NPPPRAPPAPKRTKTKLRRGKAKKTLKITGLDLLHSQTLLSTSPQAIGKKLPPAPGCVDQ
QLTALRVMPSVELSDVHNELDIPPAPADTPYALQLLLEMYRAQYLQLLELIKTPQHKLDV
KAQIETEKEKNEKLKSRAAQLEKQINVLVSDSVALLKARMSELGINATSTADLLKEAKDI
VWRHRELQARAVQLQNQVSTIEEDQAKLVSQRQKEIIEKYKKIGYANGVNESIDISTLTL
EYILKEISVTLSHRKRLQNHVTRLENELNAMEKAEEDKKILSNVPKQIVVPEKSLSQLNQ
SKSPRKSREHRSRSQEWPEVPNIEKIEENNPEILAQKILETGRQIEAGKFPSSNIKYNNS
LSNGYVANESKFSSDANIRQHNYYPPTSTNGRNVGMTKTDSTTKTKWKSQHVKEKQSYNA
NRTQEPPRLDNFEDRLKSIITSVLNEDQNNRDRQQSHQHHQNHSKPPSATVTLSQLQTQE
SYQNNNSCFYSSNGLVKQEQKSFKKAETVNREKERSQPRPDYTQVSPAKLALRRHLSQEK
LAAASAQQIQQLDEKGGLGYVATRSIGDLVSGEIERTLEISNQHIINVAIDMSPILNSSS
ASSVANNMPPKTERSGSRLSRVEDTFKKEEERVASSPSPLLRTVYSPISRPSSAEVGNPP
TPTNIIHPTTILEGLAYPHRPKSPISHNNLATLAQVAYNQQSYSANTYPHRNNNPYSNMP
YHNLPTQRQNNACRYTPVQLPRADIKPYQESYFTDMKDFKPNSTKAYTCPQPNFAPVEGL
AATLHARLLNDGSSISPANDVKEESDTAVLDCMHYDSKYNSIGRTVDKRPEIPKIEVCPP
YVEVQDKKHMAMYRSSVLSTSIVHNATIKNEIPDRNFTGRNADYKDRKSIPQKRASPVIH
GPIRSAKKSHLAESVADISSVVNNASQPLAISAISSPENNSGKSTPYNEEDRRPHEEALD
SVLDDEDKGDKWQDKISSGFDRLVAFASTELDKRRRSTEGESNASCNTSPDSGIGHGDPP
STNLMLPPGKKRFSIADIEGLCPGPKMPRLFKTPPAKPSPGRDSPPVLDPPLVIDMVNVP
RTPSPSSPPPLTINTFSPAPLDGPYSPISTTAEDLSAPHVSPSPPSLPPSVPVKYPATSD
NAVKKTPHHFKKKFFHRENWEVYDTSSNVQCRPKEKFRPKGKDWNWGGSSEFQK
NT seq 5025 nt NT seq  +upstreamnt  +downstreamnt
atgccatttaatgctataaaactagtggattacctcagtaaaatggaactgcgtttacat
agtcctgcgggtgctgaacccgttgtttatacatggcctctttcaggaggctctggctcg
catgatggtgctttggaaatcgtagaaacaataagatgggtgtgtgaagatattcccgaa
ttgaaattacctttagaaaataatattttagctgattacgatacgaaaagctacgatagt
atgaggagtctatgtgatcgattcaacagagccatcgacagcatagttcaattggaaaag
ggaacttctttaccagctgctagacttaacaagtatccgtctaggggtttattgaggcac
atattgcaacaggtttacaatcaagctgttaccgatccggaaaaactaaatcagtacgaa
ccgttttctccggaagtgtatggggaaacatcgtacgatcttatttgtcagatgatagat
caaattgaaatcacttcagatgatattttcgtcgacttgggatcgggagtcggtcaagtc
gtgttgcaaatggctgctgctactccttgcaaagtttgcttcggagtggaaaaagctgaa
gttccttcacgatatgccgaggatatgaataaaaattttaaaaaatggatgggatggtat
ggtaaaaaatacggtgaatatcatttaataaaaggggattttttaaaagccgaacacagg
gagaaaattgtttcggcaaccattgtttttgtaaataattttgcattcggtccaaacgtg
gatcattctttaaaggagagatttgcggatcttaaagatggagctagaattgtttcgtca
aaatcgttttgtcctcttaattttcgaatcacggatagaaatctttcagacattggaacg
ataatgcatgtctcggaaatgtctccgctaaaaggttccgtgtcttggactggaaaacca
gttagttattatttgcacataattgatagaacaaaacttgaaagatattttcaacgtaca
aaaaatcctcgagcgagaggtaataataacagcagtagtagtaatagtaataataataat
agtaataataaccacaataatggaggattgcaagattcaatatcgaataacatgttgcga
aattcaagagctcgaagggattcttccaagcaaacaatgaattcggttagttctgaatct
cgggattcggacgaggatagcaattgtccgctgtctacggtttctaaaaatgcccgaaat
aaatcgaccgttcggaggtacggaccagagacgaataggagaaaatctagcataagcgag
gaggaaaacaataacattcaaaacaccagcaacaataatggtaaatttaaaaaagggaca
aataaaacagttcaaaataaaaaattgcggaaaaatgttaaggctaatgataaaaatcta
aaccctccgcctagagcgcctcctgctccaaaaagaacaaaaacgaaattgcgacgtgga
aaagccaagaaaacgttgaaaattactggattagatttactccacagtcaaacattatta
agcacatctccacaagccataggtaaaaaacttcctcctgcgccgggttgtgtcgatcaa
caattgactgccttacgcgttatgccttccgtcgaactttccgatgttcataacgaattg
gatattcccccggctccggcagatactccatacgctttgcaattgcttttggaaatgtac
agagctcaatatttacagttattagaactaattaaaaccccccagcataaattagatgtt
aaggctcagatcgaaactgaaaaagaaaaaaatgaaaaattgaaaagtagagctgctcag
ttggaaaagcaaataaatgtccttgttagtgatagcgttgctttattaaaagctagaatg
tcagaacttggaataaatgctaccagtacggctgacttattaaaagaagccaaagatata
gtttggcggcatagagaactgcaagcgagagcggttcagttgcaaaatcaagtgtctaca
atcgaggaagatcaagcgaaattggtttcgcaaaggcaaaaagaaatcattgaaaagtac
aaaaaaataggatacgcaaatggtgttaacgagagcatagatatttctacgttaacgttg
gaatacatattgaaagaaatatcggttacgctgtctcatagaaaaagactacaaaatcat
gtcactagattagaaaatgaattgaacgctatggaaaaagcagaagaagataagaaaatt
ttatctaacgtaccaaagcaaatcgtggtaccggaaaagtctttgagtcaactgaatcaa
tcgaaatctcccagaaaaagtagggaacacagatcgcgatcccaagagtggccggaagtt
ccgaacattgaaaaaatcgaagaaaataatcccgaaattttggcacaaaaaattttggaa
actggaaggcaaattgaagccggaaaattccctagctctaatattaagtataataatagc
ttgtcaaatggttacgtcgcaaatgaaagtaaattttcttctgatgctaacattaggcaa
cacaattattatcctccgacatccaccaacggaagaaatgtgggaatgactaaaacggat
tcgactactaaaaccaagtggaaatctcaacatgttaaagaaaaacaatcttataatgca
aatcgtacccaagaacctcctcgtttggataatttcgaagataggttaaaaagcataatt
acaagtgttttaaacgaagatcagaataatagagatcggcaacaaagtcatcagcatcac
caaaatcattctaaacctccttcagcgaccgtaacattatcgcaattacaaacccaggaa
agttaccaaaataacaattcttgcttctattcatcaaatggtttagtcaagcaagagcag
aaatcttttaaaaaagcagaaaccgtgaatcgagaaaaggaaagatctcaacccaggccg
gattacactcaagtttcgcctgcgaaactcgcactgcgcagacatttgtctcaggaaaaa
ttagctgcagcttcggcgcaacaaattcaacaactcgatgaaaaaggaggattgggttac
gtagctactcgttctattggtgatttggtcagtggagaaatagaaagaactttagaaata
tctaatcagcatattattaatgtggctatcgatatgagccccattttaaattcatcatcg
gcaagttcagtagcaaacaacatgccacctaaaacggaaagaagcggaagtaggttatct
cgagtcgaagacacatttaaaaaagaggaagaaagagttgcgagcagcccttctcccctt
ttgcggactgtttattcccctatatcccgaccgagtagtgcggaagttggaaatcctcct
actccgactaacataattcatccgacaacaatattggaaggattagcttatcctcaccga
ccaaaatctccgattagtcataataatttggcgactttagcacaagtagcatataatcaa
caatcatattctgctaatacttacccacacaggaataacaatccgtattccaatatgccc
tatcacaatttaccaactcagcggcaaaataatgcgtgccgatacactccagttcagtta
ccccgagcggatatcaaaccctatcaagagtcttactttactgacatgaaagatttcaaa
ccaaattcaacaaaggcttatacttgtccgcagccaaattttgctcccgtcgaaggtttg
gcggctacgttacacgctcgattattaaacgatggttcttcgatttctcccgcgaatgac
gtgaaagaagaaagtgataccgccgttctcgattgcatgcactacgacagtaaatacaat
tcgatcggaagaaccgttgacaaaagaccggaaataccaaaaattgaagtttgtcctccg
tacgtggaagtacaagataaaaaacatatggcgatgtatcgaagtagtgttttaagcact
tcgatagttcacaacgcgacgataaaaaatgaaatccccgacaggaatttcacgggaaga
aatgcggattacaaagatagaaaatccatccctcaaaaaagagcttctccggttattcac
ggacccatacgttcagcgaaaaaatctcatttggccgagagcgttgcggacatttcttcg
gtggttaataatgcgagtcaaccgcttgcgatcagcgcgatatcttccccggaaaacaat
tctggaaaatcgacgccgtataacgaagaagacaggagaccgcacgaagaagctttggat
tcggttctagatgatgaagacaagggtgacaagtggcaggataaaataagcagcgggttc
gatagactggtcgcgtttgcttccaccgagttggataagcgccgtcggagcaccgaagga
gaatcaaatgccagttgcaatacgagcccggattctggaataggtcacggagatccacct
tctacaaatctcatgctaccccctgggaaaaaacggttttccatcgccgatattgaggga
ctttgtcccggacctaaaatgccccgcctttttaaaactccccctgcgaaaccctcaccc
ggtcgagattcgcctcccgtactggatcctcccctggtcatcgatatggtaaacgttccc
agaactccgtctccatcctctcctcctcctctcacgatcaacacattttctccggcgcca
ttagatgggccttacagtccgatatcgaccaccgcagaagacctatcggctcctcacgtg
tctccttctcctccttcattacccccctcggttcctgtcaaatatcccgcaacgtcggat
aacgctgtcaaaaaaactcctcatcattttaaaaagaagttttttcaccgtgaaaattgg
gaagtctacgacacctcgtcgaacgttcagtgtcgaccaaaggaaaaatttcgtcccaaa
ggaaaagattggaattggggaggaagttcggaatttcaaaaataa

DBGET integrated database retrieval system