KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM530140Help
Entry
Phum_PHUM530140   CDS       T01223                                 

Definition
(RefSeq) succinate dehydrogenase, flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00020  Citrate cycle (TCA cycle)
phu00190  Oxidative phosphorylation
phu01100  Metabolic pathways
phu01200  Carbon metabolism
Module
phu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
phu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
phu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Phum_PHUM530140
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Phum_PHUM530140
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Phum_PHUM530140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 8235135
NCBI-ProteinID: XP_002431467
VectorBase: PHUM530140
UniProt: E0VZC3
LinkDB All DBs
AA seq 634 aa AA seqDB search
MVQNVPDQIALFFLFLCVQGQYQVIDHEFDAVVVGAGGAGLRAAFGLVAEGFNTAVITKL
FPTRSHTVAAQGGINAALGNMEQDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIEL
ENYGMPFSRTDEGKIYQRAFGGQSLNFGKGGQAHRCCCVADRTGHSLLHTLYGQSLRYDC
NYFIEYFALDLIMDKNEKTCKGVIALCLEDGSIHRFRAKNTVLATGGYGRAYFSCTSAHT
CTGDGTAMISRAGLHNEDLEFVQFHPTGIYGAGCLITEGCRGEGGYLINSEGERFMERYA
PVAKDLASRDVVSRSMTIEIREGRGVGPEKDHVYLQLHHLPPEQLHTRLPGISETAMIFA
GVDVTREPIPVLPTVHYNMGGIPTNYKGQVVTVDGVGNDVVVNGLYAAGECACSSVHGAN
RLGANSLLDLVVFGRACAKTIASENKPGEKTMELSDSDGEDSVTNLDNVRYANGSISVAD
LRLKMQKTMQNHAAVFRTQETLAEGCEKMAKMYKELKNIKVYDRSLIWNSDLVEGLELQN
LMINALQTIIGAENRKESRGAHAREDFKDRIDEYNYSQPLENQQPKSIENHWRKHTLTCM
NVDTGEVTIEYRPVIDKTLDENECKTVPPAVRSY
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaaacgtgccagatcaaattgctctgtttttcctttttttatgtgttcaggga
caatatcaagttattgatcatgaatttgatgctgttgtcgttggagctgggggtgcagga
ttaagagcagctttcggtttagtagcagaaggttttaacactgctgttataacgaaactt
tttccaacaaggtcacacactgtcgctgctcaaggtggtatcaatgctgcccttggaaac
atggaacaagatgattggagatggcacatgtatgatactgttaagggttcagattggtta
ggagatcaggatgctattcattacatgactagagaagctcctaaagctgttatcgaattg
gaaaattatggtatgccattcagtagaacagatgagggtaaaatttatcagagagctttc
ggtggtcaatcgttaaactttggaaaaggtggtcaagctcatcgttgctgttgtgttgct
gatcgtacaggccacagtttgttgcacacactctatggtcaatctttacgctatgactgt
aattatttcattgaatatttcgcattggatttaatcatggataaaaatgaaaaaacatgc
aagggagttattgcattgtgtttggaagatggttcgatacataggttcagagccaaaaat
acagtattagccactggaggttatggtagagcatatttttcatgtacgtcagcacacacg
tgtacgggtgacggtacagcaatgattagcagggctggtcttcataacgaagaccttgaa
tttgtacaatttcatccaactggtatatacggtgctggatgccttataaccgaaggatgc
cgcggagaaggaggttatttaattaatagcgaaggagaaagattcatggaacgatatgct
ccagtcgcaaaagatttagcttcgcgagatgtcgtttctaggtcaatgacaattgaaata
cgcgagggtagaggtgtcggaccggaaaaagatcatgtttaccttcaacttcatcacctt
ccacccgaacaattacataccagacttcccggtatatccgagacggcaatgatattcgcc
ggcgttgacgttaccagagagccgatccccgttctaccaactgttcactacaacatgggt
ggcatccccaccaattacaaaggtcaagttgtaaccgttgacggtgttggtaacgacgtc
gttgttaatggtttgtacgcggccggagaatgcgcgtgtagctccgttcacggcgctaac
agattgggcgctaattctttactcgatttggtcgttttcggtagggcttgcgccaaaacg
atcgcatcggagaacaaacctggagagaaaacaatggaattatcggattccgacggcgaa
gactctgtaaccaatttagataacgttagatatgcaaacggatccatttccgttgccgac
cttcgtctcaaaatgcaaaaaacgatgcaaaatcacgcggccgtgtttagaacgcaggaa
acattagccgaaggatgtgaaaaaatggccaaaatgtataaagaacttaaaaatataaaa
gtctacgacaggagtctgatatggaattcggatttggtcgaaggtttagaattgcaaaat
ttaatgataaacgcattgcaaacgattataggagccgaaaatagaaaagaatctcgtgga
gcacacgcaagagaagatttcaaggatagaatcgatgaatataattattctcaaccgttg
gaaaatcaacaacccaaatcgattgaaaatcactggagaaaacatacgttaacgtgcatg
aacgtcgatacgggagaagtaacgatcgaatacaggcctgtaatagataaaacattagat
gaaaacgaatgtaaaacggtacctccagccgttaggtcgtactaa

DBGET integrated database retrieval system