KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM530530Help
Entry
Phum_PHUM530530   CDS       T01223                                 

Definition
(RefSeq) hypothetical protein
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00480  Glutathione metabolism
phu00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Phum_PHUM530530
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Phum_PHUM530530
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     Phum_PHUM530530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 Glutaredoxin GST_N_4 GST_C SH3BGR
Motif
Other DBs
NCBI-GeneID: 8235154
NCBI-ProteinID: XP_002431486
VectorBase: PHUM530530
UniProt: E0VZE2
LinkDB All DBs
AA seq 249 aa AA seqDB search
MGDSQPPLKDACLRLYSMRFCPYAQRVHLVLDSKNIKYEVVNINLSDKPDWFYDKSPEGK
VPALEFPNGETLYESLIIADYLDEKYPERPLYPKDPLAKAKDKLLMEKFNRVIRGIYKML
LHEGFSPEIMDDVKAGLDLFEKEMCIRKTKFLGGEYRKTKKKILFGSKPGMLDFMIWPWC
ERADILKIVGGDLYKLPKDRFPKILEWRVNMIADEGVRVSYLDPEIHAKYFMSRQAGTPD
YDLLHKMKH
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggggatagtcaacctccgttaaaagatgcctgccttagattatacagcatgagattt
tgtccttatgctcaaagagtgcatttagttttggattctaaaaatatcaagtatgaagta
gtcaacattaatttatctgacaaaccggattggttttatgacaaatcaccggaaggaaaa
gttccagctcttgaatttcccaatggagaaacattgtacgaaagtctcatcattgccgat
tacttggatgaaaaatatccagaacgtccattgtatccgaaagatccattggcaaaagca
aaggataaacttttgatggaaaaatttaacagagttataagagggatatataaaatgttg
cttcacgaaggtttcagtccggaaataatggatgacgtcaaagcaggtttagatttattc
gaaaaggaaatgtgcattcgaaaaactaaatttttaggaggcgagtatcgaaagacaaaa
aaaaaaatcttattcggttccaaacccggcatgttagatttcatgatatggccgtggtgc
gaaagagcggatatacttaaaatcgtcggcggagatttgtacaaacttccaaaggacaga
tttccaaaaattctcgaatggagagtcaacatgattgccgatgaaggagtcagagtgagt
tatttggatccggaaatccatgctaaatatttcatgagtagacaagcaggaactcccgac
tatgatcttcttcacaaaatgaaacattaa

DBGET integrated database retrieval system