KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM574560
Entry
Phum_PHUM574560   CDS       T01223                                 

Definition
(RefSeq) Heparin-binding growth factor 1 precursor, putative
  KO
K18496  fibroblast growth factor 1
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
KEGG Orthology (KO) [BR:phu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:phu04052]
    Phum_PHUM574560
   00536 Glycosaminoglycan binding proteins [BR:phu00536]
    Phum_PHUM574560
Cytokines and growth factors [BR:phu04052]
 Growth factors
  Growth factors (RTK binding)
   Phum_PHUM574560
Glycosaminoglycan binding proteins [BR:phu00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   Phum_PHUM574560
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 8234954
NCBI-ProteinID: XP_002432171
VectorBase: PHUM574560
UniProt: E0W1C7
LinkDB
AA seq 173 aa
MQQFSIYGESCSSNSKNSTVSKRSKWFPPNYRFNLFKGNPVFGFRMQLYCRTGYLLAIFP
DKKVRGTDEDTNPNALVELSSENFGEVKIKGLQSNLYLAMNKKGRLYGEVNGKNDATVFV
ELVYGQYNLYLSKKWAHLGWYVGIKKSGKGKPGPQTKYGQKAIQFLPRRKKYW
NT seq 522 nt   +upstreamnt  +downstreamnt
atgcaacaattttcgatttatggagagtcatgttcttcaaattcaaaaaattcaaccgtt
tctaaaagatcaaaatggtttccgcccaattacagatttaatttatttaaaggaaatccg
gttttcggttttagaatgcaactttattgtcgtactggatatttattagccatttttcca
gataaaaaagttcgcggaaccgacgaagatacaaatcctaacgctcttgtggaattgagt
tcggaaaattttggagaagttaaaataaaaggtctacaatcgaatctttatttggcaatg
aacaaaaaaggaagattgtatggagaagtaaatggtaaaaacgatgcgaccgttttcgta
gaattagtgtacggacaatataatttatatttatcgaaaaaatgggctcatttgggatgg
tacgttggtataaaaaaatcaggaaaaggaaaaccgggaccacaaacaaaatacggacaa
aaagctatacaatttttacctagaagaaaaaaatattggtaa

DBGET integrated database retrieval system