KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM615880Help
Entry
Phum_PHUM615880   CDS       T01223                                 

Definition
(RefSeq) 6-phosphofructokinase, putative
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00010  Glycolysis / Gluconeogenesis
phu00030  Pentose phosphate pathway
phu00051  Fructose and mannose metabolism
phu00052  Galactose metabolism
phu01100  Metabolic pathways
phu01200  Carbon metabolism
phu01230  Biosynthesis of amino acids
phu03018  RNA degradation
Module
phu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Phum_PHUM615880
   00030 Pentose phosphate pathway
    Phum_PHUM615880
   00051 Fructose and mannose metabolism
    Phum_PHUM615880
   00052 Galactose metabolism
    Phum_PHUM615880
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Phum_PHUM615880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:phu01009]
    Phum_PHUM615880
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:phu03019]
    Phum_PHUM615880
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Phum_PHUM615880
Protein phosphatases and associated proteins [BR:phu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Phum_PHUM615880
Messenger RNA biogenesis [BR:phu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Phum_PHUM615880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 8239812
NCBI-ProteinID: XP_002433151
VectorBase: PHUM615880
UniProt: E0W457
LinkDB All DBs
AA seq 792 aa AA seqDB search
MEPEKIKFIKRGSHKGKGLAVFTSGGDSQGMNATVRAVVRMGIYLGCKVYFIKEGYQGMV
DGGDNIVEANWSSVSSIIHKGGTVIGSARCSDFREREGRLKAAKNLVLKGISNLVVIGGD
GSLTGANLFRQEWPSLLAELVNTGEIQQEASDQYSHLHIVGLVGSIDNDFCGTDMTIGTD
SALHRIVEAIDAIASTAYSHQRTFIMEVMGRHCGYLALVTALTSEADYVFVPESPPPNDW
PEKLCSKLEQIGQLNYAERQIGQRLNIIIVAEGAIDRDGKPITAEMVKEVVVSKLKQDTR
ITVLGHVQRGGNPSAFDRILGCRMGAEAVMALMEAQPETEACVVSLDGNQAVRLPLMQCV
EKTKAVSKAMAEKDWSKAVELRGRSFHRNLEIYKMLTRLKPPTLDENKKDQGGLTLGVMH
IGAPACGMNAAVRSFVRNCIYRGETIMGIHDGIEGLCNGNVQKMTWADVTGWIALGGAML
GTKRTLPSKKFPETAAKLKEFGIQGLLIIGGFEAYQGALQLYENRDKYPEFRIPIVVIPS
TISNNVPGTDFSLGSDTALNEITEICDRIRQSAQGTKRRVFIIETMGGFCGYLATLAGLA
GGADAAYIFEEKFSIKDLQQDVYHMASKMAEGVQRGLILRNEKANDNYNTDFIYRLYSEE
GKGLFSARMNVLGHMQQGGSPTPFDRNLGTKMGAKTVEWISRKVKESLQPDGTVCANTPD
SAVLLGVIRRQYKFTPLEEIVSYTNFEQRIPMVQWWLHLRPLLRILAKHDSTYEEEGMYM
TVEETSEDNPLI
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggagcctgaaaaaattaaatttattaaaagaggttcacataaaggaaaaggtttagca
gtttttacaagtggtggagattctcaaggtatgaatgcaactgttagagcagttgttaga
atgggaatttatttgggttgcaaagtttattttattaaagaaggatatcagggcatggtt
gatggcggtgacaatattgtcgaagccaactggtcatctgtttcctcaattattcacaag
ggtggtactgtaatcggttctgcaaggtgcagtgattttagagaaagagaaggaaggtta
aaagcagccaaaaatcttgttttaaaaggaattagtaatttagttgttattgggggtgat
ggatcactgacaggtgctaatttatttagacaagaatggccttcactattagcagaactt
gtaaacactggtgaaattcagcaagaagcaagtgatcagtatagccatttacacatagtt
ggattagtcggttcaattgataatgatttttgtggaacggacatgacaatcggaacagat
tcagcacttcatagaattgtcgaagctatcgatgcgatcgcttcgactgcttattctcat
cagagaacatttattatggaagtaatgggaagacattgtgggtatttagccctagtaaca
gctctaacgagtgaagctgattatgtatttgttcctgaaagtccacctccaaatgattgg
cccgagaaactttgctccaaattagaacagattggccaattaaattatgcagaaagacaa
atcggacaacggttaaatataattattgttgccgaaggagccatcgatagagatggaaaa
ccaataacagcggaaatggttaaagaagttgttgttagcaaattaaaacaagatacgaga
ataaccgttttgggtcacgttcaacgtggaggaaatccatctgcttttgacagaattttg
ggatgtcggatgggagctgaagctgtcatggctttaatggaagctcaaccggaaacggaa
gcttgtgttgtttccctcgatggtaatcaggctgtgagactacccttaatgcaatgcgtt
gaaaagacaaaagccgtctctaaggcaatggcagaaaaagattggagtaaggctgtggaa
ttgcgtgggaggagttttcatagaaatttagaaatttataaaatgttaacaagattgaaa
cctcccactttagatgaaaataaaaaagatcaaggaggtttaactttgggtgttatgcat
atcggagcaccggcttgcggaatgaatgccgcggtgagaagttttgtacgaaattgcatt
tacagaggagaaacaattatgggaatccacgatggcatcgagggtctatgcaacggaaac
gttcaaaaaatgacttgggcggatgtcactggttggatagcattaggtggagctatgcta
ggaactaaaagaacattgccgagtaaaaaatttcccgaaactgctgccaagcttaaagaa
tttggaattcaaggattgctgattatcggtggattcgaggcatatcaaggtgctttgcag
ttgtacgaaaatagagacaaatatccagaatttcgaatacctatcgtggttattccatcg
accatatcgaataacgttcccggaacggatttctccttggggagtgatactgctttgaat
gaaataaccgaaatttgcgacaggattcgtcaatctgctcagggaaccaaacgacgagtt
ttcataattgaaacaatgggtggtttttgcggatatttagccacactcgcaggtttggct
ggtggcgccgatgctgcgtacatattcgaagagaaattttccataaaagatttacaacaa
gatgtttatcacatggcatcgaaaatggccgaaggagttcaaaggggtttgatattaaga
aatgaaaaagccaacgataattacaatacggatttcatatacagattatattcggaagaa
ggaaagggactgttcagcgccagaatgaacgttttaggacacatgcaacagggtggttcg
cccactcctttcgatcgtaatttaggtaccaaaatgggcgcgaaaacggtcgaatggata
tctcgaaaagtgaaagaatctttgcaaccggatggaacggtttgcgccaacacaccagat
tctgccgtgcttttaggtgtcattcggagacaatacaaatttacacctctcgaggaaatc
gtttcgtacactaatttcgagcaaagaattccgatggtccaatggtggcttcatcttaga
cccttattaagaattctcgccaaacacgatagtacatacgaagaagagggtatgtacatg
acggtcgaagaaacaagtgaagataatcctttaatttaa

DBGET integrated database retrieval system