KEGG   Phycicoccus sp. HDW14: G7075_08440
Entry
G7075_08440       CDS       T06484                                 

Definition
(GenBank) isoprenyl transferase
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
phw  Phycicoccus sp. HDW14
Pathway
phw00900  Terpenoid backbone biosynthesis
phw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:phw00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    G7075_08440
Enzymes [BR:phw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     G7075_08440
SSDB
Motif
Pfam: Prenyltransf TetR_C_25
Other DBs
NCBI-ProteinID: QIM21152
UniProt: A0A6G8FYE7
LinkDB
Position
complement(1709086..1709883)
AA seq 265 aa
MSASTRYEPPFPHPSGALAPVIDPRRMPKHVAVVMDGNGRWANQRGLPRTKGHEAGEAAL
LDVVAGAIEVGVTHLSAYAFSTENWKRSPDEVRFLMGFNRDVIRRRRDQLHAWGVRMRWV
GRRPRLWGSVITELETAQELTRHNTGLTLYFCVNYGGRAEIGDAVQRLAEDVARGRLKAS
RVDERTVARYLPEPDMPDVDLFVRSSGEQRTSNFLLWQSAYAEMVFQDRLWPDYDRRDLW
AAVESYVDRERRYGGAVDAPGSAPA
NT seq 798 nt   +upstreamnt  +downstreamnt
gtgagcgcgtcgacccgctacgagccgcccttcccgcaccccagcggcgcgctcgccccc
gtcatcgacccccgccggatgcccaagcacgtcgcggtcgtcatggacggcaacggccgg
tgggccaaccagcgcggcctgccccgcaccaaggggcacgaggcgggcgaggcggcgctg
ctcgacgtcgtcgccggcgccatcgaggtcggggtcacgcacctgtcggcctacgcgttc
agcaccgagaactggaagcgcagccccgacgaggtgcgcttcctcatgggcttcaaccgc
gacgtcatccgccgccgccgcgaccagctgcacgcctggggcgtccggatgcggtgggtc
gggcggcgcccgcggctctggggctcggtcatcacggagctcgagaccgcgcaggagctg
acgcggcacaacaccggcctgacgctctacttctgcgtcaactacggcgggcgcgccgag
atcggggacgcggtgcagcgcctcgccgaggacgtcgcgcgggggcggctcaaggcctcg
cgcgtcgacgagcgcacggtcgcgcgctacctgcccgagccggacatgcccgacgtcgac
ctcttcgtccggtcctcgggcgagcagcgcacgagcaacttcctgctgtggcagagcgcc
tacgccgagatggtcttccaggaccggctctggcccgactacgaccgccgcgacctctgg
gccgccgtcgagtcctacgtcgaccgcgagcgccggtacggcggggccgtcgacgcaccc
gggtcggcacccgcctga

DBGET integrated database retrieval system