KEGG   Pseudothermotoga hypogea: AJ81_03020Help
Entry
AJ81_03020        CDS       T04277                                 

Gene name
porA
Definition
(GenBank) 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
phy  Pseudothermotoga hypogea
Pathway
phy00010  Glycolysis / Gluconeogenesis
phy00020  Citrate cycle (TCA cycle)
phy00620  Pyruvate metabolism
phy00640  Propanoate metabolism
phy00650  Butanoate metabolism
phy00680  Methane metabolism
phy01100  Metabolic pathways
phy01110  Biosynthesis of secondary metabolites
phy01120  Microbial metabolism in diverse environments
phy01130  Biosynthesis of antibiotics
phy01200  Carbon metabolism
Module
phy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:phy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AJ81_03020 (porA)
   00020 Citrate cycle (TCA cycle)
    AJ81_03020 (porA)
   00620 Pyruvate metabolism
    AJ81_03020 (porA)
   00640 Propanoate metabolism
    AJ81_03020 (porA)
   00650 Butanoate metabolism
    AJ81_03020 (porA)
  09102 Energy metabolism
   00680 Methane metabolism
    AJ81_03020 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    AJ81_03020 (porA)
Enzymes [BR:phy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     AJ81_03020 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C HSV_VP16_C
Motif
Other DBs
NCBI-ProteinID: AJC73351
UniProt: A0A0X1KQ45
LinkDB All DBs
Position
complement(578574..579749)
Genome map
AA seq 391 aa AA seqDB search
METKNLMAITGAEAAAYAMKQIEPDVVAAYPITPQTPIVEYFAKYVADGEVRTEMIPVES
EHSAMSAVVGAAAAGARAMTATSAQGLALMSEIVYIASSLRLPIVMGLVNRALSAPINIH
CDHSDAMMVRDSGWIQLFCEDAQEVYDLTILAVRLAEHDDVRLPVMVNQDGFIISHGVEP
VEVLPDDVVKKFVGELKPIYPLLDTDHPVTYGALDLYDYYFEHKRQQIEAMKHAYRVFPQ
IAEEFYKISGRKYDYVEPYRMEDAEYVMVALGSSNGTIKDVVDEMRSEGKKVGLLKIWMF
RPFPKPEIQRYLTARKAVVVLDRAASFGAEAPLYEAVKSALYEVAVRPLMGSFVYGLGGR
DLKPEHVRYAFERAMALDLVADREEYLGLRE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgaagaatttaatggctataactggagcagaagcagcggcgtacgcgatgaag
cagatagagccagacgtcgttgcggcctacccgatcactcctcagacgcccatcgtggaa
tactttgccaagtacgttgccgacggcgaagttcgaactgagatgatacccgtcgaaagt
gagcattcagcgatgagcgccgtcgttggagccgctgctgctggcgcaagggcaatgact
gcgacgagtgctcaaggactggctttaatgagcgagatagtttatattgcctcttctttg
agactgcccatcgttatgggcctggtgaacagggcgctcagtgcacccataaacatacac
tgcgatcacagtgatgcgatgatggtgagagattcgggttggatccagctcttctgtgag
gatgctcaggaggtctacgatctgacgattctcgcggttcgtctcgccgagcacgacgac
gtgagactgcctgtcatggttaaccaagatgggttcatcatctcgcacggggtggagccc
gttgaagtcctgccggatgatgtggtcaagaaattcgttggcgagttgaaacccatctat
ccgttacttgacaccgaccatcccgtgacctacggtgcactggacctgtacgattactac
ttcgagcacaagagacagcaaatagaggcaatgaaacacgcctacagggtatttccacag
atagccgaggagttctacaagatcagcggtcgaaagtacgattacgttgaaccgtacagg
atggaagatgccgagtacgtcatggttgctctgggatcttccaacggaacgatcaaggat
gttgttgacgagatgaggagcgagggcaaaaaggttggactcttgaagatatggatgttc
agacccttcccgaagccggaaattcagaggtatctgacggcgcggaaggcagttgtggtg
ctcgacagggccgcatctttcggcgcggaagccccgctctacgaggctgtgaagtcagcc
ctttacgaagtcgccgtgaggccgttgatgggctcgttcgtgtacggtcttggaggaaga
gacctcaagccggagcacgtcagatacgcgttcgagagggccatggcactcgatttggtt
gccgaccgagaagagtatctcggcctgagagagtga

DBGET integrated database retrieval system