KEGG   Pangasianodon hypophthalmus (striped catfish): 113523903
Entry
113523903         CDS       T05759                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04010  MAPK signaling pathway
phyp04060  Cytokine-cytokine receptor interaction
phyp04068  FoxO signaling pathway
phyp04144  Endocytosis
phyp04218  Cellular senescence
phyp04350  TGF-beta signaling pathway
phyp04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113523903
   04350 TGF-beta signaling pathway
    113523903
   04068 FoxO signaling pathway
    113523903
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113523903
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113523903
  09143 Cell growth and death
   04218 Cellular senescence
    113523903
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    113523903
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phyp01001]
    113523903
Enzymes [BR:phyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     113523903
Protein kinases [BR:phyp01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   113523903
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH Pox_F17
Other DBs
NCBI-GeneID: 113523903
NCBI-ProteinID: XP_026765769
LinkDB
Position
Unknown
AA seq 556 aa
MCNNQFRGVLMERLGLSVLSCALLLVCTSFFTGLHASPISQTPFVLRNLCKFCDVRPSEC
NATEAHCMVHCDITSICEHSNEVCASAWRRDGENITVETVCHNPLEPFHGVILKDFNNTE
CVMKHYKQLGPDFYICSCSQEEECNEKLIFSTAETSLDKPPVSNTVLLVLVPVAVLVLVL
MSLSYFCYVHTVRPSKLQPEFSDTHSILTTKYEHSDSVSNWLNHNTELLPLHLDEMVGKG
RFAEVHRARLGQKTSENGVFQTVAVKIFPLEEFLSWRTEREIFLDAELCHENIVHFLAAE
KHTVERSLWLVTAYHARGNLRDYLRAHQLEWAELCKMGGDVVRGVAHLHSDRNAVGGAKA
PIAHRDLKSDNVLVKDDRSCCICDFGLSIRLDSNMSTEELANRGQVGTPRYMAPELLESR
LNLENIESFKQADVYSMALVLWEITSRCTAIGEVREYEPPFGKLNQLCIESMKDTVIRDR
ERPEILPSWTTHPGMKMVCEMIEECWDQDPEARLTAACVSKRFNMFSDPSFLYADSIDED
KAPELPETEAELNLNL
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgtgtaataatcagtttagaggagtgctaatggagcgactcggtctatctgtgttgagc
tgcgcactgctgctcgtctgcacttccttttttacaggccttcacgcgagtcccatctct
cagactccattcgttctgcgcaatctgtgtaagttttgtgatgtcaggccgagtgagtgt
aacgccactgaggcccactgcatggtccactgcgacatcacctccatctgtgagcacagt
aatgaggtctgcgctagtgcatggcgcagagatggcgagaacataactgtggaaacagtg
tgtcataacccattggagccgtttcacggcgtgatcctgaaagacttcaacaacacggag
tgtgtgatgaagcattacaaacagctcgggcccgatttctacatctgctcctgcagccaa
gaggaggagtgtaacgaaaagctcattttctctacagcagagacctcgctggacaagcct
ccagtgtcgaacactgtcctccttgtcctcgttcctgtcgccgtcctggtcctagtgctc
atgtcattgagttacttctgctacgttcacacagtccgtccatccaaactgcagcccgag
ttcagcgacacacattccatcctcaccaccaaatacgaacattctgacagcgtctcaaac
tggctcaatcacaacacggagcttctgcccctccatctggatgaaatggtgggaaaagga
cgcttcgctgaagtgcaccgcgcccgactcgggcaaaagacgagtgaaaacggggtgttc
cagactgtcgcagtgaaaatcttcccactggaggagttcctgtcctggaggacagagcgc
gagatcttcctggacgcagagctctgtcacgagaacatcgtccacttcctggcggcggag
aaacacacagtggagcgaagtttgtggctggtcacggcctatcatgctcgaggaaacctg
cgagactacctcagagcccaccagctggagtgggcagagctctgcaagatgggcggtgat
gtcgtaaggggcgtggctcacctgcacagtgaccggaacgcagtgggtggagccaaagcg
ccgatcgctcaccgagacttgaagagcgacaacgtgctggtgaaggacgaccggagctgc
tgcatctgcgacttcggcctcagcatccgactcgacagcaacatgagcacggaggagctc
gctaacagaggacaggtgggcacgccgaggtacatggcccccgagctgctggagtccaga
ctgaacctggagaacatcgagtccttcaagcaggcagatgtttactccatggctctggtg
ctgtgggagatcacgtccaggtgcaccgccatcggagaggtgagagagtatgagccgcca
ttcggaaagttgaaccagctgtgtatcgagagcatgaaggacaccgtgatcagagaccga
gagcgacccgagattctgcccagctggacgacacacccgggcatgaagatggtgtgtgag
atgatcgaggaatgttgggatcaggatccggaggctcgtctgacggctgcgtgtgtctcc
aagagatttaacatgttcagcgatccgtcattcctctacgctgactcgatcgatgaggat
aaagcgcccgagctcccggagacagaggcggagctaaatttaaacttatga

DBGET integrated database retrieval system