KEGG   Pangasianodon hypophthalmus (striped catfish): 113524908
Entry
113524908         CDS       T05759                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like isoform X1
  KO
K04291  lysophosphatidic acid receptor 2
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04080  Neuroactive ligand-receptor interaction
phyp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113524908
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113524908
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:phyp04030]
    113524908
G protein-coupled receptors [BR:phyp04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    113524908
SSDB
Motif
Pfam: 7tm_1 CoA_binding_3 HlyD DUF1634
Other DBs
NCBI-GeneID: 113524908
NCBI-ProteinID: XP_026767086
LinkDB
Position
Unknown
AA seq 367 aa
MTTVTMAAVAASKTCPNYSVPDYYNLTGKVISDEFRPKDYAVVTLGLTVACFVIAANILV
MSAIFINRRFHYPIYYLLGNLAAADLFAGIAYLHLMFHTGPWTAKLTVYQWFLRQGLIDT
SLTASVINLMAIALERHQTIFTMQLHSKMSNMRVILLIVGIWAIAVLMGLIPSMGWNCLC
DTDNCSKMAPMYSRSYLVFWAVLNLLSFSVMVLVYTRIFLYVRHKSQRMSQHTVQSKHKE
TVENLMKTVFVILGCFVVCWTPGLVLLLLDGVKCNCGVLKVEKFVLVLAELNSLMNPIIY
SYRDQDMRRTFKRILCWLCLRRGRTGQHADVRFNTLNQERRPAELEDSCVACKLTCVSSS
CGGENQT
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgaccactgtcaccatggcagcagtagccgcttccaaaacatgccccaattattcagtc
ccggattactacaacctgacggggaaggttatctcggacgagtttcgcccaaaggattat
gccgtggtgactctgggactgaccgtggcctgtttcgtcattgcggctaacattctggtc
atgtcagccatctttataaaccgacgcttccattaccccatctactacctgctggggaac
ctggcggcagctgacctgtttgctgggattgcctacttgcacctgatgttccacaccggg
ccctggactgctaaactcacagtgtaccagtggttcctcagacagggtctgattgataca
agtctgactgcatcagtcatcaacctgatggccatcgctctagagagacaccagaccatc
ttcaccatgcagctccacagtaagatgagcaacatgcgggtgatcctgctgattgtgggc
atctgggcaattgccgtgctcatgggtctgatccccagcatgggctggaactgcctctgt
gacacggacaactgctccaagatggcgcccatgtacagccgcagctacttggtgttctgg
gccgtcctcaacctgctgtccttcagtgtcatggtgctggtctatacccgtatcttcctc
tatgtccggcacaagagccagcgcatgagccagcatacagtgcagagcaaacacaaagag
actgtggagaacctgatgaagaccgtctttgtcattctggggtgctttgtggtgtgctgg
actccgggtctggtgctgctgctgctggacggtgtgaagtgtaactgcggcgtgctcaaa
gtagagaagttcgtcttggtcctggccgagttaaattcgctgatgaaccccatcatctac
tcgtaccgtgaccaggacatgcggcgcacgtttaagcgcatcctgtgctggctgtgtctc
cggcgtggacggacaggccagcacgctgatgtccgcttcaacacgctcaaccaagagaga
aggccagcagagttggaggactcgtgtgtagcgtgtaaattaacctgtgtttcatcctcg
tgtgggggtgaaaatcagacttga

DBGET integrated database retrieval system