KEGG   Pangasianodon hypophthalmus (striped catfish): 113526292Help
Entry
113526292         CDS       T05759                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00250  Alanine, aspartate and glutamate metabolism
phyp00410  beta-Alanine metabolism
phyp00430  Taurine and hypotaurine metabolism
phyp00650  Butanoate metabolism
phyp01100  Metabolic pathways
Module
phyp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    113526292
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    113526292
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    113526292
   00430 Taurine and hypotaurine metabolism
    113526292
Enzymes [BR:phyp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     113526292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-GeneID: 113526292
NCBI-ProteinID: XP_026769015
LinkDB All DBs
Position
Unknown
AA seq 592 aa AA seqDB search
MAAPTAPSSSSSSSCGAEPNPNTTNLRPPASSYDWSGVAHGCTRKLGMKICGFLQKNNNL
DEKSRIVASLNEQSSPQKLGLQDSHFRRTETDFSNLYARDLLPAKNGEEPTIQFLLEVVE
ILTNYVRKTFDRSTKVLDFHHPHQLLEGIEGFNLELSDQPESLEQILVDCRDTLKYGVRT
GHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIVGWPNG
EGDGIFSPGGAISNMYSVMIARYKHFPEVKTKGMSAAPRLVLLTSEHSHYSIKKASAVLG
FGTENLILLNTDERGRVIPADLEAKVVDAKRKGYVPFYVSATAGTTVYGAFDPISEIADI
CEKYNMWLHVDGAWGGGLLMSRKHRHKLHGIERANSVTWNPHKMMGVPLQCSAILVREKG
LLQGCNSMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEKHVDR
CLELSEYLYTKIKNREGFEMVFQGQPQHTNVCFWYIPPSLRGMPDEEERRQRLHKVAPKI
KAMMMECGSTMVGYQPQGDKVNFFRMVISNPAATRSDIDFLIDEIERLGLDL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccgacggctccttcctcctcctcctcctcctcctgcggcgcagagcccaac
cccaacacgacaaatttacggccacctgcgtcaagctatgactggagtggggttgcacac
ggatgcacgaggaagctcgggatgaagatctgtggatttttgcagaagaacaacaatctt
gatgaaaagagtcggattgtggcttctctgaatgaacagtcatcaccacagaagctgggt
ttgcaggactcacacttcaggcgtactgagacagacttctccaacctgtatgccagggat
ttactgcctgccaagaacggtgaagagcctacaatccagttcctgctggaagtggtagaa
atcctcacaaactatgttcggaagacatttgacagatccacaaaagtgctggacttccac
catccacaccagctcctggagggtatagagggctttaacctggagctctcagaccagccc
gagagcctggagcagattctagtagactgcagagacactctcaaatatggcgtcaggaca
ggtcatcccaggttttttaaccagctgtctactgggctggacatcattggcttggctggg
gaatggctcacctcaactgcaaacactaatatgttcacatatgaaattgctccagtgttt
gtgttgatggaacagctgactctgaaaaaaatgagggagattgttggctggccaaatgga
gaaggagatggaatattctccccaggaggagcgatctccaacatgtacagtgtgatgata
gctcgctataagcatttccctgaggtgaagactaagggcatgagtgcagcccccaggctc
gtgctgctcacttctgagcatagtcattactccataaagaaagccagtgcagttcttggc
tttgggacagagaacttgattctgctgaatacagatgagagaggtagagtcattcctgct
gatctggaggccaaggttgttgatgccaaacgcaagggctacgttccattttatgtgagt
gccacagccggtactacagtttacggtgctttcgaccccatcagcgagattgcagatatc
tgtgagaaatataacatgtggctccatgtggatggagcatggggaggtggactgttgatg
tccagaaagcacagacacaaacttcatggcattgagagggcaaattctgtcacatggaat
cctcacaagatgatgggcgttccactacagtgctctgccattctggtcagagagaaggga
cttctgcagggctgcaactctatgtgtgctggctatcttttccaaccggataaacagtat
gatgtctcttatgatactggagacaaggccatacagtgcggccggcatgtggacatcttc
aagttctggctcatgtggaaggcaaagggtaccattggatttgaaaagcatgtagaccgg
tgtctggagctctcagagtatctctatactaagatcaaaaacagagaaggctttgagatg
gtgttccagggacagcctcagcatactaatgtgtgcttctggtatattccaccgagcctg
cgtggcatgccagatgaagaggagaggaggcagaggctccataaggtggctcctaaaatc
aaggcaatgatgatggagtgtggctcaacaatggtgggctaccaacctcagggtgacaag
gtcaacttcttcaggatggtcatttccaaccctgccgccaccaggtcagatatcgacttc
ctgatcgatgagattgaaagactgggcctggatttataa

DBGET integrated database retrieval system