KEGG   Pangasianodon hypophthalmus (striped catfish): 113526444Help
Entry
113526444         CDS       T05759                                 

Definition
(RefSeq) trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113526444
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:phyp01002]
    113526444
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phyp04147]
    113526444
Enzymes [BR:phyp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     113526444
Peptidases [BR:phyp01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   113526444
Exosome [BR:phyp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113526444
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 113526444
NCBI-ProteinID: XP_026769278
LinkDB All DBs
Position
Unknown
AA seq 246 aa AA seqDB search
MKWIILLSLFAVAFTAPVDEEDKIVGGYECRKNGVPYQVSLNAGYHFCGGSLISNLWVLS
AAHCYKTRIEVRLGEHNIDVNEGTEQFISSEKVIRHSSYSSSTLNNDIMLIKLSRAATLN
SYVATVALPSGCASAGTTCLISGWGNTLSSGTNYPSNLRCLNAPILSDTTCRNAYPGEIT
SNMFCAGFIEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALQNKPGVYTKVCNYTAWIR
DTMSRN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggatcattttactttctctgtttgcagtggcattcactgcccctgttgatgag
gaggataagattgttggagggtatgagtgcagaaagaatggtgtgccgtatcaggtgtct
ctgaatgctggataccacttttgtggaggctctctgattagcaatctgtgggtcttgtca
gctgctcattgttataagacgcgtattgaggtgcgtttgggggagcacaacattgatgtc
aatgaaggaacagagcagttcattagctcggagaaagtcatcaggcactccagttatagc
agcagcactctcaacaatgatatcatgctcatcaagcttagcagggctgccaccctgaat
agctatgtggcgactgtggctttgccctctggctgcgcttctgccggtacaacgtgcctc
atctctggatggggaaacaccctcagcagtggcacaaactacccttccaatctgaggtgc
ttgaatgccccgatcctgagtgacaccacttgcagaaatgcttaccctggtgagatcact
tccaacatgttctgtgctggcttcattgagggaggcaaagattcttgccagggagattct
ggtggcccagttgtgtgtaacggtcagctgcagggtatcgtgtcctggggttacggctgc
gctctccagaataagcctggtgtctacaccaaagtctgcaactacactgcctggatcagg
gacaccatgagccgcaattaa

DBGET integrated database retrieval system