KEGG   Pangasianodon hypophthalmus (striped catfish): 113526734
Entry
113526734         CDS       T05759                                 

Gene name
adcy3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00230  Purine metabolism
phyp01100  Metabolic pathways
phyp04020  Calcium signaling pathway
phyp04114  Oocyte meiosis
phyp04261  Adrenergic signaling in cardiomyocytes
phyp04270  Vascular smooth muscle contraction
phyp04371  Apelin signaling pathway
phyp04540  Gap junction
phyp04912  GnRH signaling pathway
phyp04914  Progesterone-mediated oocyte maturation
phyp04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113526734 (adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    113526734 (adcy3)
   04020 Calcium signaling pathway
    113526734 (adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113526734 (adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113526734 (adcy3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    113526734 (adcy3)
   04914 Progesterone-mediated oocyte maturation
    113526734 (adcy3)
   04916 Melanogenesis
    113526734 (adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113526734 (adcy3)
   04270 Vascular smooth muscle contraction
    113526734 (adcy3)
Enzymes [BR:phyp01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     113526734 (adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA fn3_4 Calmodulin_bind
Other DBs
NCBI-GeneID: 113526734
NCBI-ProteinID: XP_026769841
LinkDB
Position
Unknown
AA seq 1146 aa
MHFLRTTCLKSNRDNKDLFFILQVTYWLFRMPRNRAFSEPEYSAEYSADCSVTLPSDPGQ
AVGRTHEVTVRNSGCCLCLPRFMRLTFTPDSLENLYQTYFRRQRHETLLVLVVFAALFDC
YVIVMCAVVYTSDKLASVAVACVALAVDIVLYLLCRYGLLPERISRRLVPYALWVLIDAQ
IFCYLGLNFARFHQASDTVGWQAFFSFSFFLTLPLRLTPIVLITAVSCGVHTLALGVTIA
QQQQEDIQGAALGRQLLANILIYICAITVGLMSYYMADRKHRKAFLEARQSLEVKLNLEE
QSQQQQRLLLSILPKHIADEMLQDMKKEASQKEMQQFNTMYMYRHENVSILFADIVGFTQ
LSSSCSAQELVKLLNELFARFDKLAAKYHQLRIKILGDCYYCICGLPDYREDHAACSIMM
GLAMVEAISYVREKTQTDVDMRVGVHSGTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGI
PGRVHISQSTLECLHGEFDVEPGNGGDRCEYLRERGIETYLVVVPKGPVSKNGINGVKLS
VTSSNGNSPLLINTTECNGSVHTGCTTPEEPEELDTRVVNPSFPNPRRRLRLRDLAERVI
DAQENEQELNKLLNEALLERETVQALKGKYTNRLSLRFVNPELETRFSVEKEKQSGAAFS
CSCVVLLFTAAIEALIDPLLIANYVTLAVGEVLLLILTICSLAAIFPRVFPKRLVSFSTW
IDHTRWARNTWAMAAIFILTLADIIDMLSCQPPQPVGDVSPAPGGLGGCLENPKYYSYIA
VLALIATTMLVQVSHMVKLTLMLLITVASGIVNIYSWRDIFDQYDLTHYKKYRIYLVPSK
YTMTVMIFIMMVSFYYFARHVEKLARTLFLWKIEVHEQKEKVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASIPNFSDFYTEESINNGGIECLRFLNEIISDF
DSLLDEPHFRCITKIKTIGSTYMAASGVTPDTNANGYACMKQKEELSDRERWQHLADLAD
FALAMKVTLMNINYQSFNNFMLRIGLNKGAVLAGVIGARKPHFDIWGNTVNVASRMESTG
VMGNIQVVEDCYNILKDYGFRFVRRGPIFVKGKGELLTYFLKGREKQGSFINGSSVTLPH
QVVDSS
NT seq 3441 nt   +upstreamnt  +downstreamnt
atgcactttttaagaaccacttgtttaaagagtaacagggacaataaggatctatttttc
attcttcaagtaacctattggctcttcagaatgcctcggaaccgggccttctccgagccg
gagtactctgctgaatattcagcagactgctcggtcacactgccctccgatccgggccaa
gcagtgggaagaacccacgaggtcaccgtgcgtaactcaggctgctgtttgtgtctccct
cggttcatgcgtctcacattcaccccagactcactagagaacctctaccagacctatttt
cggaggcagcggcatgaaaccctgctggtgttggtggtgtttgcagccctcttcgactgc
tatgtgattgtgatgtgtgccgtggtctataccagtgataagctggcgtctgtggctgtg
gcctgcgtagcattggctgtggacatcgtgctctacctactgtgccgctacggccttctg
cctgagcgcatttctcgccgactggtgccctatgccctgtgggtgctcatagatgcccag
atcttctgttatctaggattgaactttgcccgcttccaccaggccagtgacacagtaggc
tggcaggccttcttcagcttctccttcttcttgacactgccgttacgactgacaccaatt
gtgctcatcacagctgtgtcatgtggcgtgcacacgttggcgctgggagtcaccatcgca
cagcagcagcaagaagacatccaaggagctgctctcgggagacagctgttggccaacatc
ctgatctacatatgtgcaattactgtggggcttatgtcatattacatggctgatcgcaaa
caccgcaaggcctttttggaggccaggcagtctctggaggtgaagctgaatttagaggaa
cagagtcagcagcagcaacgtctactgctgtccattctgcccaagcacatagcagacgag
atgctacaagacatgaagaaagaggccagtcagaaagagatgcagcagttcaacactatg
tacatgtatcgccatgaaaatgttagtattctgtttgcagacattgtgggattcacccag
ctctcctcttcctgtagtgcacaggagctagtcaagctgctcaatgagctgtttgcccgc
tttgacaaactggctgctaaatatcaccaactgaggattaagatcctcggggactgctac
tactgtatctgtggccttccagattaccgagaagaccacgcagcctgctccataatgatg
ggattggccatggtggaagctatttcctatgttcgagagaagacgcagacagatgttgac
atgcgtgttggggtgcattctgggacagttcttggtggggtgctgggacagaagcgctgg
caatacgatgtctggtccacagatgtcacagtggccaacaaaatggaggctggaggtata
cctgggcgagtgcacatctctcagagcacactcgagtgtcttcatggtgaatttgatgtc
gagccagggaatggaggcgaccgctgtgaatatctgagggagagaggcattgaaacttac
ctggttgttgttcccaaaggaccagtgagcaagaatggcatcaatggagtgaagctgtcg
gtaacttcatctaatgggaactctcctctgttgatcaacactacagaatgtaatggcagt
gtacacacaggctgcaccacacctgaagaaccagaggagctggacacacgggtggtgaat
ccctcgtttccaaaccctcggcggcgtcttcgtttgcgagacctggctgagagagttatt
gatgctcaggaaaatgagcaggagctgaataaactcctgaacgaggcactgctggagaga
gagacagtgcaggcattaaagggaaagtacactaaccgcctttcgctgcgctttgtgaac
cctgagctggagacacgtttctcagtcgaaaaggagaagcagagtggagccgccttcagc
tgttcctgtgtagtgctgctttttacagcagcaattgaggcacttatagatcctctgttg
atagccaactatgtgactctagctgtgggggaagtgctgctgctcattctcaccatctgc
tccctggcagccattttcccacgggtatttcctaagagactggtgtcattctctacatgg
attgatcacacacgttgggctcgcaacacttgggccatggcagccatattcatcctcaca
ctggctgacataatagacatgctaagctgccagcctccacagcctgttggggatgtttct
ccagccccaggtggactaggtggttgtctggagaaccccaaatattacagttacatagct
gtattagcgctgattgctactaccatgctggtgcaggtcagccacatggtgaagcttacg
ctgatgctactgatcacagtagcctcgggcattgtcaatatttacagctggagggacatc
tttgaccagtatgatctaacccactataagaagtacagaatatacctcgtgccctccaaa
tatacaatgactgtgatgatcttcatcatgatggtcagcttctactactttgcacgacat
gtggagaaactggcccgcacgctgttcctgtggaaaattgaggtacatgagcagaaggag
aaggtgtacgagatgagacgctggaacgaggctctagtcacgaacatgctcccggagcat
gttgcccgccactttctgggctccaaaaagagggatgaggaactgtacagccagtcctat
gatgagattggggtcatgttcgcctctatcccaaatttctccgacttctacacagaggag
agcatcaacaatgggggcattgagtgtctgaggttcctcaatgaaattatctctgacttt
gatagtcttctagatgagcctcattttcgctgtataaccaagattaagactatcggcagc
acttacatggcagcatccggagtcactcctgacaccaacgctaacggctatgcttgcatg
aagcaaaaggaggaattgtctgatagggagcgctggcagcacttggcggatctggcagat
tttgctttggccatgaaagttactctgatgaacattaattatcagtcctttaacaacttc
atgcttcgcattgggttgaataagggtgctgttcttgccggggtcataggggctcggaag
cctcattttgacatctggggcaacactgttaatgtggctagtcgcatggagtctacagga
gtgatgggaaacattcaggtggtggaagactgctataacatcctgaaggactatggcttc
cgttttgtgagaagaggaccaatcttcgttaaagggaagggagagttgctcacttatttt
ctaaaaggacgagaaaaacagggttccttcatcaatggctcctctgtcacactgcctcat
caggtggtggacagctcttga

DBGET integrated database retrieval system