KEGG   Pangasianodon hypophthalmus (striped catfish): 113528081
Entry
113528081         CDS       T05759                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04068  FoxO signaling pathway
phyp04217  Necroptosis
phyp04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113528081 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113528081 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113528081 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phyp03000]
    113528081 (stat3)
Transcription factors [BR:phyp03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    113528081 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2
Other DBs
NCBI-GeneID: 113528081
NCBI-ProteinID: XP_026772194
LinkDB
Position
Unknown
AA seq 788 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQTAT
TAQQDGQAAQHSGTVVTEKQQLLEHRLQDIRKKVQDMEQKMKMLENLQDDFDFNYKTLKS
AGELSQDLNGNSQAAATRQKMAQLEQMLSALDQLRRQIVTDMAGLLQAMDFVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPIV
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPELN
YQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFAEIIMGYKI
MDATNILVSPLVYLFPDIPKEEAFGKYCRPEAQPDADIQDLSGCVTQPYLKTKFICVTPC
PSIFMDLPDSELLANGFPGTNSGNTSDLFPMSPRTLDSLMHNEAEANPGPLESLTLDMDM
NTDVASPM
NT seq 2367 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttgcagcagttggagacacgctacctggagcagctgtaccat
ctgtacagtgacagcttccctatggagctccgccagtttcttgctccctggatcgagagt
caggactgggcgtatgcagccaataaggagtctcacgccacgctggtgtttcataacctg
ctgggagagatcgaccagcagtacagccgcttcctgcaggagaacaacgtcctttaccag
cacaacctgcggcgcatcaaacagcacctgcagagcaagtacctggagaagcccatggag
atcgctcgcatcgtcgcacgctgtctgtgggaggagcagagactgctgcagaccgccacc
actgctcagcaagatggccaggccgctcagcacagcgggacagtggtgacggagaaacag
cagctcctggagcacagactgcaggacatcaggaagaaagtgcaggatatggagcaaaaa
atgaagatgctggagaacctacaggatgactttgatttcaactacaagactctgaagagt
gcaggagagctgtcccaggacctgaatggaaacagccaggctgcagccaccagacagaag
atggcccagctggagcagatgctgagcgccttggatcagctcaggaggcaaatcgtgact
gacatggcagggctgctgcaggctatggactttgtgcagaagaatctgactgatgaggag
ctagctgattggaagaggagacagcagattgcctgcatcggaggacctcccaacatttgc
ctggaccggctagagacatggatcacatcattggctgagtctcagctacagatcaggcag
cagataaagaaactggaggagctccagcagaaagtgtcatataaaggagaccccatagtt
cagcaccgccctgccctggaggagaagattgtagacctcttccgcaatctcatgaagagt
gcgtttgtggtcgagagacagccgtgtatgccgatgcaccccgacagacctctggtcata
aagacaggagttcagttcaccaacaaagttcggttactggtgaaattcccggaactgaat
tatcagctgaaaatcaaagtttgcatcgacaaggaatctggagatgttgcagccattcga
gggtcacgcaagttcaacatcctgggcactaacaccaaggtgatgaacatggaggagtcc
aacaatggcagcctgtcagctgagttcaaacacctgactctgcgagaacagaggtgtggt
aatggtggccggaccaacagtgatgcctctctgatcgtcactgaggagcttcatctcatc
acctttgagactgaggtgtaccaccagggcctcaaaatcgaccttgagacacactctctt
cctgttgtagtcatttctaatatctgccagatgcccaatgcctgggcttccattctgtgg
tacaacatgctgactaaccatcccaagaatgtaaatttcttcacaaaacctcctgtgggt
acatgggatcaggtggctgaagttctgagctggcagttttcctccacaaccaagagaggc
ctgactattgagcagctcaccacactggctgagaaactgcttggtccttgtgtgaactac
tccggttgtcagatcacttgggccaagttttgcaaagagaacatggcaggaaaagggttc
tcattctgggtttggttggataacatcattgacctggtaaagaagtacattctggctctg
tggaatgaggggtatatcatgggtttcatcagtaaggagcgagagagggccatcttgagc
ccaaagcctcctgggacatttctgctgcgtttcagcgagagcagtaaggagggtggcatc
acattcacctgggtggaaaaagacatcagtggtaagacacagatccagtcagtggaacca
tacactaagcagcagctcaacagcatgtcctttgccgaaatcatcatgggctataagatc
atggacgccacaaacatcctggtgtctccgctcgtctaccttttccccgacatccctaaa
gaggaggcctttgggaagtactgcaggccagaagcccagcctgatgcagatatccaggat
ttatccggatgtgtcactcagccatacctgaagaccaagttcatctgcgtcaccccgtgt
ccttccatcttcatggaccttccggacagtgaactactggctaacggcttccctgggact
aactcgggtaacacaagcgacctgttccccatgtctcctcgcactctcgattctctgatg
cacaatgaagctgaggccaacccgggacctctcgaatccctcactctggacatggacatg
aacacggacgtggcctcgcccatgtga

DBGET integrated database retrieval system