KEGG   Pangasianodon hypophthalmus (striped catfish): 113528261Help
Entry
113528261         CDS       T05759                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04010  MAPK signaling pathway
phyp04210  Apoptosis
phyp04625  C-type lectin receptor signaling pathway
phyp04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113528261
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113528261
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113528261
   04672 Intestinal immune network for IgA production
    113528261
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phyp01001]
    113528261
Enzymes [BR:phyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     113528261
Protein kinases [BR:phyp01001]
 Serine/threonine kinases: STE group
  Other
   113528261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 113528261
NCBI-ProteinID: XP_026772509
LinkDB All DBs
Position
Unknown
AA seq 863 aa AA seqDB search
MAVVQRIFNSTQPFSMSTNQPKLKVHSCHASSPEPQSPVTSGKDDKQYELTDYSNYFLKV
ISHGTAKHVGTGPLGTEKPSIIAQAECESQDSQEFCPNSRHKNVYSNFRAALPLPQGSVS
HRQPRKKRRKRQRRRVSQREGQQRDGGSERVRERRLTRVPQQDSGELGECSYLSSNSSSA
ISTESLSVQETAEPSYSSHPGLISTPLSSKPWECLFIPPHGLVSYGQESECSLDPDSPLI
SEAECSLALVGLRNNVSQAECSFASAFAKQMVRDVRDRQEEEDGEEETVESDTNEGILFK
EELQPQDYEYREGRDYELCDLLKQGSFGVVYSIRDKSSGFVCAAKKVPLERFRSEEVGSW
SALQSPHVVEFFGFVREGQSVILFMDLKPGSLGQLLAERGRLPEDLSLHYMCQVLGALEH
LHKRRILHLDVKVDNVLLSEDGKNTFLCDFGESERLDLYGFSPFQALKGTETHMAPEVAR
GEKRCAKVDVWSSCCMLLHMLNGCQPWTRYYSRPLYLKIAEEPPPLREIPPNCSPHTADV
IKRGLQREPSRRASAKDLRVQTVKALKQLGGLRSPARGGAYQKPFGKPERCVPSPFSDSS
VQQWMGPGQEWREQAGLRAEPKCHRQQVEKVDAVKEENDREEEIVLRKESYLSPSSPLYF
HFSPPESYKPTEQELRKLEREFFLSSLSQPHSAELQEQLLSCLGSDCLSSREPGDKKDSG
RWSLGPGDDLSSGVFSYNSQSDGQSFSMDWLGPVHQPPPRCFEGVDVCIRDFNGRCLRIR
ETRRVKVGHIAIGISDQISESVFSLQSEDGSLVPHDKQVQEAGLFLRCVPAPDPTHVPRH
SQGSCCNMPWSWRIKDGRLETRD
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggtacagaggatctttaattccacccagcccttctccatgtccacaaaccag
cctaaactcaaggtccacagctgccatgcttccagccccgagcctcagtctcctgtcacc
tctggaaaggacgataaacagtacgagctgacggattattccaactactttttgaaggtc
atctctcatggaacagccaagcatgtaggcacaggacctctgggcaccgagaagccctcc
atcatcgcccaagcagagtgtgaatctcaggactcgcaggaattctgtcccaacagcaga
cataaaaatgtgtacagcaacttcagggcagccctccccttaccccaaggctcggtctct
caccgccagcctaggaaaaaacgacggaagagacagcggcggagggtttcacagagggag
ggccaacagagggatggagggagcgagagagtgagagagagaagactcactagagtgcca
caacaggacagcggagagcttggagaatgtagctacctcagcagcaacagcagcagtgca
attagcacagaaagtctgtctgtgcaggagacagcggagccgtcctactcctctcaccca
ggcctcattagcactccgctatcttccaaaccctgggagtgccttttcattcccccgcat
ggcctggtatcctatggccaagagagcgagtgctcgctggaccccgactcgccgcttatc
agtgaagccgaatgcagcctggcacttgtaggcctcaggaacaacgtttcacaggccgag
tgctcctttgcctcggcgtttgccaaacagatggtcagagacgtgagggacagacaagaa
gaagaggatggagaggaagagacagtagagagcgacacaaatgaaggcatcctctttaaa
gaggaactacagccacaggactatgaatatcgagagggaagggattacgagctctgtgat
ttactaaagcaaggctcgttcggagtcgtctacagcatcagagacaaatccagcggcttt
gtgtgcgctgccaaaaaggtgccgttagaacgtttcagaagtgaggaggtgggctcgtgg
agtgccctccagtctcctcacgtggtggaattttttggatttgtccgagagggtcaatcc
gtcatcttgttcatggatctcaaacctggctctctggggcagttgttggcagaaaggggt
cgcctgcccgaggatctctccctgcactacatgtgtcaggtcctgggggcactagagcac
ctgcacaagagacgcatcctacacctggatgtcaaagtggataatgtgttgttgtccgag
gatgggaaaaacacattcttgtgtgactttggcgagtcagagcgactagacctatatgga
ttcagtccttttcaagctctgaaggggacggagactcacatggctcctgaggtggcacgt
ggagagaagcgttgtgccaaggtggatgtgtggagcagctgctgcatgctattgcacatg
ctcaacggctgccagccatggacacgctactactcccgccctctctacctcaaaatagct
gaagagccgccacctctgagagagatacctcccaactgcagccctcatactgctgatgtc
atcaaacggggactgcagagagagccgagccgaagagcctcagccaaggatctcagagtt
caaacagttaaagcacttaaacaactgggaggtcttcggagcccagccaggggaggagcc
tatcaaaagccatttgggaagccagaaaggtgtgtgcccagccccttctccgatagctct
gtgcagcagtggatgggcccagggcaagagtggagagagcaggctggactgagagctgag
ccaaagtgccatagacaacaagtggaaaaagtggatgctgtgaaggaagagaatgacaga
gaggaagagattgtgctgagaaaggaaagttacctttctccatcttcaccactctacttt
catttttcaccccccgagtcctacaaacccacagagcaagagcttcgcaaactcgagagg
gaatttttcctgagcagtctgtctcagccgcactcggccgagctgcaggagcaacttctt
tcctgcctgggtagtgactgcctttctagcagagagccaggagacaaaaaggactctggc
cgctggtcacttggccccggggacgacctcagctcaggtgtattttcctacaacagccaa
tcggatggccagagcttcagtatggattggcttggccccgtccaccagcccccacctcgc
tgctttgagggagtggatgtttgcatcagggacttcaatggacgatgcctccgtatccgt
gaaacccgccgtgtaaaagtgggtcacatcgctataggaatcagtgatcagatctcagag
agtgtgttcagtctgcagagtgaggacggttctctggtgccccacgataagcaagtacag
gaagctggcctcttcctgcgctgtgtccccgcccctgaccccacccatgtcccacggcac
agtcaaggctcctgctgcaacatgccatggagctggaggatcaaggacgggaggctggag
accagggactga

DBGET integrated database retrieval system