KEGG   Pangasianodon hypophthalmus (striped catfish): 113528477Help
Entry
113528477         CDS       T05759                                 

Definition
(RefSeq) uncharacterized protein LOC113528477
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM192
Motif
Other DBs
NCBI-GeneID: 113528477
NCBI-ProteinID: XP_026772849
LinkDB All DBs
Position
Unknown
AA seq 1923 aa AA seqDB search
MCECCTCERRGKGFFRHRLAALQEWEHSNDPLGQKYRFRETDLRLNREKGNSTPSPFLPV
SNPACSVKNSQQTKRNAPTVSSRTTKTKRWKREERIKQAEKTQHNHFISSLSHFNLKDSS
VCLYSHSVDFLLSCRDPASNERALLYTIESVRPRLESRDSDVLGPPSPDDVRLIRGEEAR
DISNDVSSNTDELNLKPFTLSSVSSAGHRDPANAKGQEAETAAPAAAVRVVHQMAISSRT
RNMLRTRLRCSGAFDRGKLSRLNKKAVKMIRRTSKLRAGARPHGRCRRGAVRKGSPRKQR
SRFNKTRRETNSKSSPAITEEKQQGSFGDSHKATADGEERITVSGAAREGDSSSPNASGI
SGELQKKHIPSVVSGTINVTTSSTPFSSAHSPLPLPPPPPPPLASSSSSSSSLPSGLKRY
VKVSLVRVSIPGERAAVKADQERADSGENAHPTSPAAVEKQISKCKRSKGISRLGVKKGV
REMYFTPSADSFLKVTCDIESSGNAVAQPVAQLTHKGSKRNNEEIEEIETMKENNSNNKR
DNMASDSVCVEKSLLENSEVVTHLRKRGQVPKGQTKQSETNIAEEKDEEKRKGDVTKQNE
DTVQKKSDLLRFGSKTIVIKEARVLLSDILKSLSSELVSQGLDGKAYHSVVRNSSRHGES
ESIKRLISLTNIPKVNFEPLKKSPAIARVTHVAQRSAQISQDHHGAKVAKKKDPEIIPMS
SESLSPLKGSLDHNSQSSIPLKKRVFRESLETDPDQDASVTTTTTESPCPSKSLEARTES
LLPASQGSETFDNGAQNLTLQSSSSFRDEGVGSKKGRLCKSLVAKKLRQRKCFRTAQARP
GAPNRMFRERGSTGNALAAKTPEIRVNMNRKCKMKSELGARVERIDAGRKINEDVREAGQ
NLAMETQKNAKAEADALSASESSFNTEDEQNINFRIRLKRKRGKEWEMESEIKGESAVVE
TQSSEPRSDVIDPFKAILDSVAILNLEMERIRGHGEADKSVGLEQATKAVQDVLEHCQKE
STFKSRKRRKKISGASINSEKHAKGQEVSVHSKMEFPEVLEQQSQFVRHLKVEADNMDIK
PLPLLRLRRRAEGRWEVDGEEAHAQDGNTGPGNSVLRDSRILSCFFPERMPTGEMAFSRV
KEENLSPCQHRTTASKCDRIRELSKGAVTSEPSLLSLSPLSLNSPYHEGLTEISHLARVK
ETFAPERVENLESAELGEVCLSHNLLQINKSLSKLQAMSQQQPSCAPVNISATTSCQIQS
KPLSPPSSPFTTECTFSNYSEDILDFHCLNLDGYDQTHAQSGLQNTLTDYCSGEPHNTGS
FSSPFSQSPADGWNPETPYLGSPSPGSSFSTPEDLSFPDLGLTRYDTPSLNSEFSSKDKA
FCPVTMGSAAVRDSERNVFFSDSTSTKRNVIFQSREDSATPLICVADKTLGNQRDLIIFN
TSLNAKQTVPSAACSQSQDKIHFLDSSRSLSAQSDFAKIQPKDKNNEPLNFVSSINKSQP
SVLSQSGPGLYNAGLQSNPVKPFHSLHTGSKTTSCSELPGPLNLGSTVFRGYEKKPTVFQ
NYSSLVKIEGGGYGQNVCKGSSVGDSKLSLKPHGSKSELPDPVPGPSSLRNHKDLSSECS
QSAYMRYSETSRRDTKTVPPNKGLSKAHPQSDRVYPVYFLSSSKTAANAIKSMPIEKPQN
VRVGSSVNPDIPSTFFHSAQSHSILNSKNLRQDKPHAVVAPSQSSQVSVPLDRNQLCFSH
CDPLDVSFSSSLSSAVSQHSSPQVSYRDSVGQEAPATKPQPSSFVCNQSAHPSYVVNFTG
DHSVTLNYNDGGECLNYSSSVPTNYTYHCLMEPSGTQGRLIVEPCGPSTITHSPSMGSFA
GPKGMAETSKDSQQHGQSGCHPVISHHFPSSHSQSASLTDRKPKRLRLVVTDGTVDLDLQ
YTD
NT seq 5772 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaatgttgcacctgtgagaggagaggaaaagggtttttccggcacaggctggcc
gcgctgcaggagtgggaacactcgaacgatccgctaggccagaagtacagattcagagag
acggatttgcggctcaaccgggagaaagggaacagcactccgagtccattcctcccggta
tctaacccagcctgctctgtgaagaattcccagcagacgaagagaaacgcccctacagtg
agcagcaggacgacaaagaccaagaggtggaaaagggaggagcggatcaaacaggctgag
aagacgcaacacaaccacttcatatcatcgctgtctcatttcaacctgaaggactcgagc
gtgtgcctgtacagtcacagcgtggacttcctcctaagctgcagggatcccgccagcaac
gaacgagcgcttctgtacacgatcgagagcgtgagaccaagattagagagtcgggactcg
gacgttctcggccctccgtctcccgacgacgtcagactaatcagaggtgaggaagcacga
gacatctctaacgacgtatcgagtaacactgacgaattgaacttaaaacccttcacgtta
agctcggtttcgagcgccggtcatagagaccccgcaaacgctaaaggacaggaggcggaa
accgccgcccctgccgccgccgtcagagtcgtacatcagatggccatttcttcacggacc
aggaatatgcttcgcacccgactcagatgctctggagcttttgatcgaggtaaactctct
cgtttgaataaaaaggcggtcaaaatgatacgccggacttctaagctgcgcgcaggcgct
agacctcacggccggtgtaggagaggtgctgtcagaaaaggcagtccgcgtaaacaaagg
tcacgcttcaacaaaacccgacgagaaacaaacagtaagtcatctccagcgatcacagag
gagaagcagcagggcagctttggggattctcacaaggccacggctgacggcgaggagcgc
atcactgtctccggcgctgctagggaaggggattcgagctccccaaatgcttcagggatc
tccggggagctgcagaaaaaacacatcccttctgtcgtttctggcacgatcaatgttacc
acatcctcgactcctttttcctccgctcactcgccacttccactacctcctcctcctcct
cctcctttagcttcttcatcttcttcatcctcttctcttccttcagggttgaagcgttac
gtaaaagtcagtctggtcagagtgtcgatcccaggagagcgagcagctgttaaggcagat
caggaaagagcagacagcggagaaaacgcacatcctacatctccggcagctgtagagaag
cagatctcaaagtgcaaacgaagcaaaggtatctcgagactcggtgttaagaaaggggtg
agggagatgtactttactccgagtgcagacagctttttaaaggtgacgtgtgacatagaa
agtagcgggaatgccgtagcacaacctgttgcacagctgacacataagggtagcaagaga
aataacgaagaaatagaggaaatagagacgatgaaagaaaataacagtaacaataagaga
gacaatatggcttctgattctgtatgtgttgagaaatctttgttagagaacagcgaagta
gtgactcatttaaggaaaagaggacaagtgccaaaaggtcaaacaaaacagagtgaaaca
aatatagctgaagaaaaggatgaggaaaagcgtaaaggtgacgtaactaagcaaaatgaa
gatactgtacaaaagaaatcagatttgttgcgttttggaagcaaaactatcgtcataaaa
gaggcaagagtccttctgtctgatattttaaaaagcttgagcagtgaattggttagtcaa
gggctggacggtaaagcgtatcacagcgtagtcaggaattcttcgcgacacggtgagtca
gaatcgattaaaaggttgatatcccttactaacatcccaaaagtgaattttgagcctctg
aaaaagagccccgcgattgcgagagtaacccacgtggctcagcgtagcgcacagatttca
caagaccatcatggcgcaaaagtggcaaaaaaaaaagatccagaaattattccaatgtcc
tccgagtctctctcccctctaaaaggcagcctggatcacaattcccagagcagcatcccg
ctaaagaaacgcgtctttcgagaatccctcgaaaccgatccagatcaagacgcaagcgtg
actacaactacaacggagtctccgtgtcccagtaaaagtctggaggccagaacggaaagt
ctgttacccgcgtctcaagggagcgagacctttgataacggagctcagaacttaacttta
cagtcgagctcttctttcagagatgaaggagtaggatcaaaaaagggcaggctgtgtaaa
tccttagtggctaaaaagctacgacaaagaaaatgttttcgaactgctcaggctagacct
ggagctccaaataggatgttcagagaaagaggtagtacaggtaacgcattggcagcgaag
acacctgaaattagagtaaatatgaatagaaaatgcaaaatgaaatctgagctaggagcc
agagtggagcgaatcgatgcagggagaaaaataaacgaggacgtaagagaggctggacaa
aatttagcaatggagacgcagaaaaacgcaaaagccgaagcggacgccttgtccgcttcg
gaatcttcatttaacacggaagatgagcagaatataaattttagaatacgtctgaaaagg
aagagggggaaggagtgggaaatggagagtgaaatcaagggggaaagtgctgtggttgaa
acacagagttcggaaccacgctccgatgtcattgacccctttaaagctattttggattct
gtcgcgatcttaaacttggaaatggagcggattcgaggccacggcgaagcagacaagagc
gtcggcctggagcaagccactaaagctgttcaagacgtcttagaacattgccaaaaagaa
agtactttcaaatccaggaaaaggcgtaaaaagatatctggtgctagcatcaacagcgaa
aagcatgctaaaggacaagaagtctctgttcatagtaaaatggagtttcctgaggtgcta
gaacaacagagtcagtttgtaagacatctcaaagttgaagctgataatatggacatcaaa
ccgttgcctctgcttcggttgcgacgccgggccgagggcagatgggaggtggacggcgag
gaagctcacgcacaagacggaaacacgggaccgggaaattctgtgctaagggactcccgg
attctgtcctgcttttttcctgagaggatgccgacgggagagatggcgttcagcagagtc
aaagaggaaaacctgtctccgtgccagcaccggactacagctagcaagtgcgacaggatt
agagagctctctaaaggtgcggtcacttcagagccttcgctactgtccctttcaccctta
tctctgaactctccgtatcacgaaggactaacggaaatatcccatctcgcaagagtcaaa
gaaacgtttgcgccagaaagagtcgagaatctggaaagcgcggagttgggcgaggtttgc
ttaagtcacaacttgcttcagatcaacaaaagcctctcgaaacttcaagccatgagccaa
cagcagccatcatgtgcacctgttaacatcagtgcgactacctcctgtcagattcagtcg
aaaccgttgtctcctccctcctcccctttcaccactgaatgcaccttttcaaactattca
gaagacattttagattttcactgcttgaacctcgacggctacgatcaaacgcacgcacaa
agcggcctccaaaatacactgacggactactgctccggcgaacctcataacaccggatct
tttagtagccccttctctcaaagcccagcggacggatggaacccagagaccccttacctc
ggctctccgagcccggggagtagctttagtactccagaagacttgagttttcccgatctt
gggcttacgcgatacgacacgccatcgttaaacagcgagttctcttccaaagacaaagca
ttctgtcccgtgacgatgggttcggccgccgtcagagattcggaaaggaacgtgtttttt
tctgatagtacgtcgacaaagcgcaacgtgatctttcagtccagggaagattctgcgacg
cccctgatttgtgtggcagataaaacattaggcaaccagagagacttaataatatttaac
acatccttaaacgctaagcagaccgtcccttctgcggcttgctcccagtctcaggataaa
atacatttccttgacagctcaaggagtctgtcggcgcagtcggacttcgctaaaattcaa
cctaaggacaaaaataacgagccgctcaacttcgttagctcgattaataaatcccagcct
tccgtcttgagtcagtctgggccaggtttatacaatgctggattacagagcaaccctgtt
aaacccttccactcgcttcatacaggaagcaaaaccacctcatgctcggagttaccaggg
cctcttaaccttggcagtacggttttccgtggctatgaaaagaagcctacggttttccag
aactacagcagtttggtgaaaattgaaggaggaggatacggtcagaacgtttgcaaaggt
tcttcagtaggtgactctaaactctctttgaaacctcacggcagcaagtctgaacttccc
gaccccgttccagggccatcgagtttacgcaaccacaaggatttatcctccgagtgttct
cagagtgcatatatgagatactctgaaacctcaagaagagatacaaagactgttccacca
aacaaaggactgtctaaagcacacccgcagagcgatcgggtttaccccgtttactttctc
agctctagcaaaaccgcagcaaacgccattaagagcatgcctatcgaaaagcctcagaac
gtaagggttgggagttccgtcaatcctgacattccttctacattttttcatagcgctcag
agtcacagcatacttaacagcaaaaacctaagacaggataaaccccatgccgtcgtagcc
ccaagtcagagctctcaagtctcggttccgcttgacagaaatcagctctgtttctcacac
tgtgatcctttagacgtctccttcagctcttcgctgtcctccgccgtttcccagcacagc
agtccgcaagtgagctacagagattccgtcggtcaggaagctccagcgaccaaacctcag
ccgtcctccttcgtgtgcaatcaatccgctcacccgtcttacgtcgtgaacttcaccggt
gatcactcggtcacgctgaactacaacgacggcggggaatgtttgaattattcttcgtcg
gtgcccacgaattacacttaccattgcctcatggagccttccggaacccaggggaggctt
atcgtagaaccgtgcggtccgtcgaccatcacgcattctccttctatgggcagcttcgcc
ggccctaaaggcatggcggagacgagcaaggactctcagcagcacgggcagtccggatgc
catccggtcatttcccatcacttcccgtcgtctcactcgcaaagcgcctctctgacggac
cgcaagcccaagagactgcggctggtagttactgacggtacagtagatctggacctgcag
tacacagactga

DBGET integrated database retrieval system