KEGG   Pangasianodon hypophthalmus (striped catfish): 113529534
Entry
113529534         CDS       T05759                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113529534
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phyp03000]
    113529534
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:phyp03310]
    113529534
Transcription factors [BR:phyp03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    113529534
Nuclear receptors [BR:phyp03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   113529534
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 113529534
NCBI-ProteinID: XP_026774573
LinkDB
Position
Unknown
AA seq 760 aa
MEPGGVKNSTKRDEHLMTLNFSESPAEGVLHNGARSTMSFAPTTVVPPVSPLLQPVTGDL
PNGVSNTPPPEDITITLPSPLELFVEDADLKMVGKDLRSQQSFQQQSSVGLYSLGDNFSR
LEASIADLNSSLPSVDSLIGGGDPSLFPLKNEDFSPMGKGEMDLEQDPFGKDVDASNPKL
FGENTMDLLQEFDLPESPTDFYVGDDEFPPLVDDSLLGVIVSDKDSKSVDSVSTSTTTNI
NSVNGATSSTPSSVSTNSPSLVVKQEKETMIHLCTPGVIKQENTSERSFCQMTPDLSSTV
RNVSIAICGVSTSSGQSYHFGSPVSSGSQQKDQKPVFNVYTPQATGDEWGRGFINASTMQ
QRASNSFTATQSFGTNYASSTARPEANTATSSGTGKASSTHKICLVCSDEASGCHYGVLT
CGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLMAGMNLEARKAKKLK
MKCVQQANTAELSPPPMPEVQALVPKAMPQLVPTMLSLLKAIEPETIYAGYDSTVTDTST
RLMTTLNRLGGRQFISAVKWAKALPGFRNLHLDDQMTLLQSSWLFLMSFGLGWRSYQQSN
GNMLCFAPDLVINEERMKMPYMGDQCAQMLKISNEFVRLQVSNEEYLCMKVLLLLSTVPK
DGLKSQSVFDEIRMSYIKELGKAIVRREENSSQNWQRFYQLTKLLDSMHDMVGGLMNFCF
YTFVNKSLSVEFPEMLSEVISNQLPKIKAGSVKPLLFHQK
NT seq 2283 nt   +upstreamnt  +downstreamnt
atggagccgggaggtgtgaagaacagcacgaagagagatgagcatttgatgacgctgaat
ttcagcgagagcccagctgagggagttttgcataacggagcacgcagcaccatgtcattt
gccccaaccactgtagtgcctcctgtcagtcccctgttgcagcctgtgactggagatctc
cccaatggtgtgagcaacacgcctcctccagaggatatcaccatcaccttgccatccccc
ctggagctcttcgtggaggatgcggatctgaaaatggttgggaaggacttgaggtctcaa
cagtcctttcagcagcagtcctccgtggggctctacagcttgggggataacttctcacgt
ctggaggccagcatcgctgatctcaacagctccttgccatctgtggattccttaatcgga
ggaggggatcctagtctgttccccctgaaaaatgaggacttctcaccaatggggaaaggg
gaaatggatctagagcaggatcctttcgggaaagatgtggatgccagtaacccgaagctc
ttcggcgagaacaccatggaccttctgcaagagttcgacttgcccgagtctcccacagat
ttctatgtgggagatgatgaattccccccgttggtcgatgactctctgctaggagtcatc
gtttcagacaaggactcgaagtctgtagactcggtgagcaccagcaccaccactaacatc
aacagcgtcaacggtgccaccagctcaactccctccagtgtgtccacaaacagcccatcc
ctggtagtcaagcaggagaaggagaccatgatccacctgtgtactccgggcgtgatcaag
caggagaacaccagcgagaggagcttctgtcagatgaccccagacctgtcgagcacagtt
aggaacgtttccattgccatctgtggtgtcagcacatccagcggtcagagctaccacttt
ggaagccccgtgtccagcggcagccagcagaaagatcagaaacccgtttttaacgtgtac
acgccgcaggctacaggtgacgagtggggccggggtttcattaatgcaagcacgatgcag
cagagggcaagcaacagcttcaccgccacccagagcttcggcaccaactatgccagctcg
actgccaggcctgaggccaacactgccacgtcctcaggcacagggaaggccagcagcaca
cacaaaatttgcctggtgtgttcagacgaggcgtcgggctgccactacggagtactcacc
tgcggcagctgcaaggtcttcttcaaaagagccgtggaagggcaacacaattacctgtgc
gcggggcgcaatgactgcatcatcgacaaaatccgcaggaagaactgtcccgcgtgccgt
ttccgcaagtgcctcatggctggcatgaacctggaagcacgtaaagccaagaagctgaag
atgaagtgtgtacagcaggcgaacacggccgagctgtctcctcctccgatgcctgaggtg
caagctctggttcccaaagccatgccgcagctggtgcccaccatgctgtcgctgctcaaa
gccatcgagcccgagaccatttacgccggctacgacagcacagtcacagacacctccaca
cggctcatgaccaccctgaacagactgggaggacgccagttcatctccgccgtcaagtgg
gccaaagcactgcccggtttccggaaccttcacctggatgatcagatgactctgctccag
tcctcctggctcttcctcatgtcgtttggtctgggctggagatcttaccagcagtctaac
ggcaacatgctctgtttcgccccagacctggtgatcaatgaggagaggatgaaaatgccc
tacatgggtgaccagtgtgcacagatgctgaagatttccaatgagtttgtgagactgcag
gtgtcgaatgaggagtacctgtgcatgaaggtccttctgttgctcagcacagtgccaaag
gacggtctgaagagccagtctgtgttcgacgagatcagaatgtcatatattaaagaactg
ggaaaagccattgtgaggagggaagagaactccagccagaactggcaacgattctaccag
ctcactaagctactggactccatgcacgacatggtgggtggactgatgaacttctgcttc
tacacgtttgtgaataagtcactgagcgtggagtttcctgagatgctttccgaggtcatc
agcaaccagctgccaaaaatcaaagccgggagcgtcaagccgctgctctttcaccagaaa
tga

DBGET integrated database retrieval system