KEGG   Pangasianodon hypophthalmus (striped catfish): 113530070
Entry
113530070         CDS       T05759                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04010  MAPK signaling pathway
phyp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113530070
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113530070
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:phyp04052]
    113530070
   00536 Glycosaminoglycan binding proteins [BR:phyp00536]
    113530070
Cytokines and growth factors [BR:phyp04052]
 Growth factors
  Growth factors (RTK binding)
   113530070
Glycosaminoglycan binding proteins [BR:phyp00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   113530070
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 113530070
NCBI-ProteinID: XP_026775578
LinkDB
Position
Unknown
AA seq 157 aa
MTEVEITAHVSHSADKLNLSGLNHTELRRLYCMNGGYHLQLLPEGSVRGSREEHDPYSVL
QIKAVSAGVVVIEGTEAKRFLSMSDDGKLYGSLSVTDESHFLEKLEENNYNTYKSQKYGP
NWYVGIKKNGKPKRGSRTHTGQQAIFFLPQQEDQGRD
NT seq 474 nt   +upstreamnt  +downstreamnt
atgacagaggtggaaattacagcacatgtttcccacagtgcagataaactgaacctcagc
gggctgaaccacacagagctgaggcgactctactgcatgaatggcggctatcacctgcag
cttctccctgagggctcagtgagaggaagcagagaggaacacgacccttacagtgtgttg
cagattaaagctgtgagtgctggagtggtggtcattgagggaacagaggccaaacggttc
ctctctatgagtgatgatggcaagctgtacggatcactgtcagtaactgatgaaagtcac
ttcctggagaagttggaggagaacaactacaacacgtacaagtcccaaaagtacggccca
aactggtatgtcggaataaaaaagaatgggaaaccaaagcgaggctcgaggacacacact
ggacaacaggccattttctttctacctcagcaggaggatcaaggaagagactaa

DBGET integrated database retrieval system