KEGG   Pangasianodon hypophthalmus (striped catfish): 113530655
Entry
113530655         CDS       T05759                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04010  MAPK signaling pathway
phyp04210  Apoptosis
phyp04620  Toll-like receptor signaling pathway
phyp04621  NOD-like receptor signaling pathway
phyp04622  RIG-I-like receptor signaling pathway
phyp04623  Cytosolic DNA-sensing pathway
phyp04625  C-type lectin receptor signaling pathway
phyp04920  Adipocytokine signaling pathway
phyp05132  Salmonella infection
phyp05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113530655 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113530655 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113530655 (ikbkg)
   04621 NOD-like receptor signaling pathway
    113530655 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    113530655 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    113530655 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    113530655 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113530655 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113530655 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    113530655 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phyp01001]
    113530655 (ikbkg)
Protein kinases [BR:phyp01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   113530655 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 DUF3496
Other DBs
NCBI-GeneID: 113530655
NCBI-ProteinID: XP_026776648
LinkDB
Position
Unknown
AA seq 608 aa
MVQPQPYVDSAFQWDMAGEEAVGAASQGSLTNSSQGSLRVPPELAGHEVVNRLLLDNHQL
REALKRSNDALKNRCEEMEGWQRRTREEREFLNGKFHEARALVERLAQENKNLLGKLNPN
GSHVEPQGTAIGTETACQNRNQESNGLMEDSNELAVVERKVDAEQDTDRQGSSENSSLNS
YIPSFGESLPCGQEGRACRPNEGSNEILKMLKSHKEKLEQGMRELRRRNEELEKEKMESK
KENECLLITVDQLRFKVTQLTQTGAVTEDTFQKTNACTVSAESFHLAKLTEQLQATQGRY
RELQEKLNLLEQNTVQRDRTEALLKQKEKDYIQLTKDSEALRAQVTSLLGELKERQTSLD
KCEEEKRRLEERLCCKTDNLQTLERDMEEQKKQHCVTVDKFLLQTQNLEAALKTERAVIV
EERRKLAQLQHAYTCLFQDYDSKLKTEKLANHRSGETETLTHRLEEAEKALALKQAHIDK
LKEEVEQQRTLQETIEVLTAQAEIYKSDFHAERRAREELNQKKEELQEKLNQTLTELNLH
KQEKMQQRHMDSYRPLPHLPPPAVMPGAGIPQPNRNAPEMQPEYQCPKCQYNAPDMDTLQ
IHVMDCIQ
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggtccagccccagccttacgtggacagcgccttccagtgggacatggcaggagaggag
gcagtgggggctgccagccaaggctcactaacgaatagttctcaaggatcactaagggtg
ccacctgaattagctgggcatgaagtggtcaacagacttcttttggataaccaccagtta
cgagaggcactaaagaggagcaatgatgccctgaaaaacaggtgtgaggagatggaggga
tggcagcgaagaactagggaggagagagaatttctgaatggcaagtttcatgaggcacgg
gctttggttgagcgactggctcaggagaacaagaatttgctgggcaagctcaaccccaat
ggcagtcatgtagaacctcaaggcactgctatcggcacagagacagcatgtcaaaatcgg
aaccaagagagtaatggactgatggaggattctaatgagttagccgtggttgagcggaag
gttgatgcagaacaagacactgacagacagggatctagtgagaatagttccctcaatagt
tatattcccagttttggtgaaagcttgccctgtgggcaagagggcagggcctgtcggcct
aatgaaggttctaacgaaatcctaaagatgctgaagagtcataaagagaagctagagcaa
ggaatgagagagcttagaagaagaaatgaggaactggagaaggagaaaatggagagtaaa
aaagagaatgaatgccttctgataactgtggaccagctacgcttcaaagtgacacagctt
actcagactggtgctgtaacagaggacacgtttcagaaaacaaatgcttgtaccgtctct
gctgaaagctttcacttggctaaactaacagaacagcttcaggctactcaaggcaggtat
agagagcttcaggaaaaactgaacctactagaacagaacacagtgcaaagggatagaact
gaggcgctactcaagcagaaagagaaagattatattcagctgaccaaggacagtgaggct
ctgagggctcaggtcacttctctacttggtgagctgaaagagcggcagacatccctagac
aagtgtgaagaggagaaaagacgtttagaagaaaggctgtgctgtaagacagacaacctg
cagactctggagcgtgacatggaggaacaaaagaagcagcattgcgtgaccgtggacaaa
ttccttttgcaaacacagaacctggaggcagcactgaagacagaacgggctgtcattgtg
gaggagaggaggaagctagctcaactccagcatgcttacacctgtctctttcaggattat
gactccaaactgaaaactgaaaagctagccaatcacaggagtggagaaacagagacgctt
actcacagactagaggaagctgagaaagctctggccttgaaacaagctcatatcgacaaa
ctcaaggaagaagtggagcagcagaggaccttacaggagaccattgaagtgcttacagca
caggcggagatctataagtcagacttccatgcagagagaagagcacgagaggagctcaac
caaaagaaggaggagctgcaggaaaaactgaaccaaacactgactgaactcaatctccac
aagcaggagaagatgcagcaaagacacatggacagctacagacctctcccacacctgcca
ccacctgcagtaatgccaggcgctgggataccacagccgaatcgcaatgcccctgagatg
cagcctgaataccaatgccctaagtgtcagtacaatgctccggacatggataccctgcag
attcatgtcatggactgtatccagtga

DBGET integrated database retrieval system