KEGG   Pangasianodon hypophthalmus (striped catfish): 113531277Help
Entry
113531277         CDS       T05759                                 

Gene name
dcc
Definition
(RefSeq) netrin receptor DCC isoform X1
  KO
K06765  deleted in colorectal carcinoma
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
SSDB OrthologParalogGFIT
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig Pur_ac_phosph_N V-set Interfer-bind C2-set_2 Ig_6 Ig_4 Protocadherin EphA2_TM Shisa Arylsulfotran_N
Motif
Other DBs
NCBI-GeneID: 113531277
NCBI-ProteinID: XP_026777684
LinkDB All DBs
Position
Unknown
AA seq 1446 aa AA seqDB search
MARAGGYERVRGALAGAVWMALLCIVSRTQGSQTPRSFVELRFVLEPQDVVTIRGGVLQL
DCQARSDRGLPSISWKKDGVLLSSVVDERRQQLANGSLLVQNVVHSRHHRPDEGAYQCLA
TLEGVGAIVSRTAKVTVAGPLRVVVPTESVSSYMGDTALLRCEVTGEPMPVVRWQKNRDE
LPLTFDPDSRVVVLPSGSLQVSKVQPPDAATYRCLAENPGSARTGTDADLRVLPEPGVVR
NLVFLQRPMKVTALQGRDAVLECSASGYPTPSFYWMRGSEMIQIRSRKYSLLGGSNLLIS
SITDDDSGAYSCVAYNKNENITSSCELSVLVLPQFLNYPSNTYAYESSDIEMECAVTGNP
QPTVRWMKNGEAVIPSDYFQIVDGGNLQILGLVRSDEGFYQCVAENEAGNALAMAQLILL
ELVVPSSGVLPSFPRDVTPVLVSSRFVRLSWRPPVETRGTILTYGVFYTQEGINRERSVN
ATEPDSLQLTVNNLKPEAVYIFRVVAYNEQGPGESSEQIRLSTQPELQIPGPVENLQAEA
MSPTSIQASWDPPAYANGPIQGYRLLWTETSTGKEQSIEVLGQSYKMEGLKKFTEYSLRV
LALNRHGPGITTEDKLITTFSDVPSAPPQNISLEVIYSRSIKVSWQPPPANTQNGFITGY
KIRYRKTGRRGEQEAIEPNNLWYLFTGLEKGSQYSFQVAAMTVNGTGPSSEWYTAETPEN
DLDETQVPNQPSSLHVRPLPNSIIMSWTPPLNPNILVRGYIIGYGVGSPYADTVRVDSKQ
RYYSIENLEPSSHYVISLKAFNNAGEGVPLYESAVTRSMSDPVDPSDDDLFHLFDNFPTP
IPDTSTPMIPPVGVQAVALSSDSVRVSWADNSMSKNQKSSETRYYSVKWRGSHSSSSKYK
SADTTGLSHTVTGLKPNTMYEFAVMVTKGRKSSTWSMTAHATTYEAAPSSAPKDLTVIGR
EGRPRSILISWQPPLEANGKITGYIVYYTLDKNMAIDDWVMEPISGDRLTHQVMDLNLDT
VYYFRIQAKNAKGVGPLSDPVQYRTSKVEHPDKMANDQGRHGDSGYWPSDNNLIDRSSLN
EPPIGQMRPPHGSVTPQKNSNLLVIIVVSVGAVTVVVVVIVALICTRRSSAQQRKKRATH
SAGKRKGSQKDLRPPDLWIHHEEMELKNIEKPSSSAPSGRESPIQSCQEIAPVSHSQSES
QMGSKSSHSGGDADEASSGISTLDRSLASRRATRSKMMIPMDSQPSNTPVVSAIPVPTLE
SSQYPGILPSPTCSYTPHSKFTLRPMPFSTLTVDRGYAAAITTETPQPQASLIPSVQPEA
TGAEEMPSRSIPTACVRPTHPLRSFTNPLLPPPMGTIEPKVYTPMMPQPGGSLPKPQVKT
ASLGQAGKARSPLLPVSVPTAPETAEEGQKPAEDPASVYEQDDLSEQMASLEGLMKQLNA
ITGSAF
NT seq 4341 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgccggtggatacgagcgtgtgagaggggctctggctggtgcagtttggatg
gctttgctgtgcatcgtctccaggacgcagggttctcagacgccacgtagttttgtagag
ctgcgtttcgtgttggagccgcaggacgtggtaacaataagaggtggtgtactacagctg
gactgccaggcacgatctgaccgtggccttccctccatctcatggaagaaggatggcgtg
ctgctgagctcggtggtggacgagcggagacagcagctggcgaatggatcacttctagtg
cagaatgtggtgcactcgcgccatcaccgacctgatgagggagcctaccagtgtttggcc
actctggagggcgtaggggccatcgtcagccgcacagccaaggttactgttgctggtcct
ttacgtgtggtggtccccaccgagtcggtctcgtcctacatgggtgacacagcattgctg
cgctgcgaggtgacaggcgagcccatgcctgtagttcgctggcaaaagaaccgcgacgag
ttgcccctgacctttgaccctgacagcagggtggtggtgctgccctccggctcactgcag
gtcagcaaggtgcagccacctgacgctgccacctaccgctgcctggcggagaacccgggg
agcgctcgcacaggcacggacgctgatctgagggtattaccggagcctggagtagtgagg
aatctggtcttcctccagagacccatgaaggtcacggctctacagggcagagatgctgtg
ctggaatgttccgcctctggctacccaaccccctccttctactggatgagaggcagcgag
atgatccaaatcagatcgaggaagtactcgttgctcggcggcagcaacctgctaatcagc
agcatcacggatgacgactcgggcgcgtacagctgcgtagcgtataacaaaaacgagaac
atcacttcttcatgtgagctctctgtgctagtgttgccccagttcttgaactacccatcc
aacacgtacgcatacgagagctcggacatcgagatggagtgtgcggtgacgggtaaccct
cagcccaccgtgcgctggatgaagaatggagaagcagtcatccccagtgactacttccag
atcgtggatggtgggaacctgcagattttgggcctggtgcgttcagatgaaggattctac
cagtgtgtggcagagaacgaagcaggcaatgccctggcaatggcccaacttatactcctg
gaactcgttgtcccgagctcaggcgtcctcccctccttcccccgggacgtgacccccgtg
cttgtgtccagccgctttgtgcgcctttcctggcgcccccctgtggagacgcgtggcacc
atcctcacctacggagtcttctacacgcaggagggcatcaacagagagcgttcggtgaat
gcgacggagccagacagtctccagttgacggtgaacaatctgaaacctgaggcggtttat
atcttcagggtggtggcctacaatgagcaggggccaggagagagctctgagcaaatccgg
ctctcaacacagcctgaattgcagatccctggtcctgtggaaaacctccaagccgaggcc
atgtccccgacctccatccaggcctcatgggatcctccagcatacgccaacggccccatc
caaggctaccggctcctctggaccgagacctccactggcaaagagcagagcatagaggtg
cttgggcaaagctacaaaatggaaggattgaagaagtttacagagtattcgttacgtgtc
ctggcactgaaccgccacgggccgggcatcaccacagaagataagctcatcacaaccttc
tctgatgttccgagtgctcctccccagaacatctctctagaagtgatctactcgcggagt
attaaagtgagctggcagcctcctccggccaacacacagaacggtttcatcaccggctac
aagatccgctaccgtaaaacgggccggcgaggagagcaggaagccatcgaacccaacaac
ctgtggtatctgttcacagggctggaaaaaggcagtcagtacagctttcaagtggcggcc
atgacggtcaatggcacaggccctagcagcgaatggtacactgcagaaacgccagaaaac
gaccttgatgagacccaggttccaaaccagccaagctccctgcatgtccggccccttccc
aacagcatcatcatgagctggacacccccactgaaccccaacattttggtgaggggttac
atcattggctatggcgtagggagtccctatgctgacacagtacgagtggacagcaagcag
cgctactactccattgaaaacttagagcccagctcccattacgtgatctcactaaaggcc
ttcaataatgcaggagaaggtgtaccactgtatgagagcgctgtcaccagatccatgtca
gatcctgttgacccatcagacgatgatttgttccatctgtttgataattttcccaccccc
atcccagatacgtccactcccatgatcccccctgtaggcgtgcaggctgtggctctctcc
tcggactcagtcagggtgagctgggccgataactccatgagcaaaaaccagaagagcagc
gaaacgcgctattactccgtcaaatggaggggcagtcactccagcagcagcaagtacaag
tctgcagacaccacaggactgagtcacacggtaacaggtctgaagcccaacaccatgtac
gagtttgctgtcatggtaacgaaaggccgcaagtcgagcacctggagtatgacggcacac
gccaccacgtatgaagcagcaccgagctccgccccgaaggacctgactgtgattggtcga
gagggtcgtcccagatcaattctcatcagctggcagccgccactcgaagctaatggcaag
ataacaggttatatagtgtactacacattggataagaacatggccatcgatgactgggtg
atggagcccattagtggagacagactcacccaccaggtcatggatctgaatctcgacact
gtctactatttccgcatccaggccaaaaacgccaagggggtggggcctctctctgacccc
gtccagtacaggacatccaaagtcgaacatccggacaagatggccaacgaccaaggtcgt
catggagacagtggctactggccttcggacaataacctgattgacaggagcagcctgaat
gagccacccattggtcagatgcggcctccacatggcagcgtgactccacagaagaacagc
aacctgctggtgatcatcgtggtgtctgtgggcgccgtcaccgttgtcgtcgtggtcatc
gtggctctcatttgcacgcgccgatcctccgcacaacaaaggaaaaagcgggccacacac
agcgcagggaaaaggaaaggaagtcagaaagacctgcgacctcctgacctgtggatccac
catgaggagatggagctgaagaacatcgagaaaccgtccagctccgccccgtccggccga
gaatcgccaatccagagctgccaagagattgcccctgtcagccacagccaatcagagagc
cagatgggcagcaagagtagccactcaggtggtgacgcagatgaagcctccagcggcata
tccactctagaccgctccctagcctcacggagggcgactcgctcaaagatgatgatccct
atggactctcagcccagcaatacaccggtggtcagtgccatcccggttcccacgctggag
agcagtcagtacccgggcatcctgccgtctccaacatgtagctacacccctcattctaaa
ttcaccctcaggccgatgcccttttccacgctcactgtggaccgaggctatgccgcagcc
ataaccacagagaccccccagcctcaggcgtctctgatcccctccgtgcagcctgaagca
acgggggcagaggagatgccgagccgctccattcccacggcgtgtgtaagacccacacac
cccctgcgtagcttcaccaaccccctcctgcccccgcccatgggcaccatcgagcccaaa
gtctacactcccatgatgccacagccaggtggcagtctccctaaaccccaagtcaagaca
gcttcgttaggacaggctgggaaagccagatcaccgctacttcctgtctccgttccgaca
gcacccgaaaccgcagaggaagggcagaaaccagcagaagaccccgcaagtgtatatgag
caggacgacctgagcgaacagatggccagtctagagggactgatgaaacagctgaacgcc
atcaccggctcggcattttaa

DBGET integrated database retrieval system