KEGG   Pangasianodon hypophthalmus (striped catfish): 113531770
Entry
113531770         CDS       T05759                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04012  ErbB signaling pathway
phyp04068  FoxO signaling pathway
phyp04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    113531770 (cdkn1b)
   04068 FoxO signaling pathway
    113531770 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113531770 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 113531770
NCBI-ProteinID: XP_026778466
LinkDB
Position
Unknown
AA seq 157 aa
MSDVRLSNGSPPLERVDARPEGHSKPSVCRNLFGSPDPGEVRRAYLDELRESEVAYREKY
NFDFAKDTPLEPGRYEWVPVDARDAPEVYSRPPRAARRVDLNGSQTDCQKAHSAAKKRPS
LEDADCARQSKRVNHGEEASSSQDRAEQTPRKSDPST
NT seq 474 nt   +upstreamnt  +downstreamnt
atgtcggacgtgcgtctttctaatggaagtccgccgctggagcgcgtggacgcgagaccg
gagggacacagcaagccgtcggtgtgcaggaacctgttcggatcaccggacccgggggaa
gtcaggcgagcgtatctggacgagctgcgggagtcggaagtggcgtacagggagaaatac
aacttcgactttgcgaaggacacgccgctcgagccgggcagatacgagtgggtgccggtg
gacgccagagacgcgcccgaggtttacagcaggccgccgcgtgcagccagacgggtggat
cttaacgggagtcagacggactgccaaaaagcgcacagcgcggcgaagaaaagaccttcc
ctggaggacgcggattgtgcacggcagagtaaaagagtgaaccatggcgaagaagccagc
agcagtcaagacagagcagagcagacacccagaaaatcagatcccagcacgtaa

DBGET integrated database retrieval system