KEGG   Pangasianodon hypophthalmus (striped catfish): 113532417
Entry
113532417         CDS       T05759                                 

Definition
(RefSeq) uncharacterized protein LOC113532417
  KO
K05461  KIT ligand
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04010  MAPK signaling pathway
phyp04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113532417
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    113532417
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:phyp04052]
    113532417
Cytokines and growth factors [BR:phyp04052]
 Growth factors
  Growth factors (RTK binding)
   113532417
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 113532417
NCBI-ProteinID: XP_026779636
LinkDB
Position
Unknown
AA seq 257 aa
MVHMKEVKIGGCACVLVLLFSGLVACSGVFGSPLTDDVATLDTLRENIPKDYKIRVRYIS
KNVGGTCWVHLNLYPAESSLKNLALKFGNLSANRENITIFITMLQGLRFTIDNDELESTM
QAFKCHYRSARWSTRRYFDHVKEVLVTFASTPRQFYCTPPPCPTPTAPPVMSDRRVIDRA
IPGVLALVIIPCLAALALILRAVLRRKLCCAERRREQTNDMEPQSDPEASIDASHNGSES
SFLNNQCRVQQVEDTGV
NT seq 774 nt   +upstreamnt  +downstreamnt
atggtccacatgaaggaggttaagatcggagggtgcgcatgtgtgttggtgttgttattt
tccgggcttgtcgcctgctctggtgtgtttggaagccctttgactgacgatgtggccaca
ctagacacactgagagaaaacattcccaaggattacaaaattcgtgttcgttacatttcc
aaaaacgtgggagggacgtgctgggttcacctgaacctgtatccagcagagagcagtttg
aaaaacctagccctgaagtttggcaacctttcagccaacagagaaaatattactatcttc
atcaccatgctgcaaggactccgcttcaccatcgataacgacgagctggagtcaacaatg
caggcctttaagtgtcattatcggagtgcacgatggtccaccagacgctacttcgaccac
gtcaaagaggttcttgtaacatttgcctcgacaccccgccagttttactgtactcctcct
ccatgtcccacccctactgcacctccagttatgtcagatcggcgtgtgattgacagagcg
atccctggtgttctagcgttagtcatcattccctgtcttgctgcacttgcactcattctc
agagcagtgcttcgtcgaaaactgtgctgtgcagaaaggagacgtgaacagaccaatgac
atggagccacaaagtgaccctgaagccagtatagatgcgtcacacaatggcagtgaatca
tccttcttaaataaccaatgcagggtgcagcaggttgaggacacaggagtttaa

DBGET integrated database retrieval system