KEGG   Pangasianodon hypophthalmus (striped catfish): 113532892Help
Entry
113532892         CDS       T05759                                 

Gene name
galnt17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00512  Mucin type O-glycan biosynthesis
phyp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    113532892 (galnt17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:phyp01003]
    113532892 (galnt17)
Enzymes [BR:phyp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     113532892 (galnt17)
Glycosyltransferases [BR:phyp01003]
 O-Glycan biosynthesis
  Mucin-type
   113532892 (galnt17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 113532892
NCBI-ProteinID: XP_026780398
LinkDB All DBs
Position
Unknown
AA seq 606 aa AA seqDB search
MIRFRLLLSLMAFMMRRWKVLVVLNVFAVAGFFTFWGKCDVRPNKIINGHTRLNGSSSDP
SISHEVLLKRLGSLEDVVYRQLNGLSKSLGLIEGFRGQGKGGFPATLTPEEEKQAKYLQE
KYGYNAFLSDRISLDRSIPDYRPSKCKNMFYPRDLPQISLIFIFVNEALSVILRSVHSAV
NHTPPHLLKEIILVDDNSDDEQLKGPLEEYVNKRYPGLVKIVRNQKREGLIRARIEGWKI
ATGEVTGFFDAHVEFTPVWAEPVLSRIKQDPKRIVLPSIDNIKHKSFGLERYENSGHGFN
WELWCMYISPPKQWWDEGDTSAPIRTPAMIGCSFVANRHYFGELGLLDSGMDVYGGENIE
LGIRVWLCGGSMEVLPCSRVAHVARTKKPYHSNIAFHTRRNALRVAEVWLDEYKSNVYLA
WNIPMESHGIDYGDISERVALRKKLQCKNFEWYLDNIYPEMRRYNSTLFYGEIRNSNVTH
LCMDQGLKENHTATLHPCHGWNPQLGRYTKEGYLFVGPLGSTGEDTYCVIDDMISSFPQL
VNCDKVSNIGQKTWNFAQNESIVNRATGRCLEVVKANVSFGYALVLQACTGQRWNIKNTM
KQQQGL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgatccggttcaggttgctgttgtccttaatggcttttatgatgagaagatggaaggtg
ttggtggtgctgaacgtgttcgcagtagcaggcttcttcactttttggggcaagtgtgat
gtacggccgaacaaaattatcaatggtcacactcgcctcaatggatcttcttcagaccca
agcatcagtcatgaggtcctgctgaagaggcttggctcattggaagatgtggtctacaga
cagctaaatggtttgtccaaatctcttggtcttattgagggcttcagaggccagggcaaa
ggtggctttcctgccacactgactcccgaggaggaaaagcaagccaaatatctgcaagag
aagtacggctacaatgcattcctgagtgacaggatttctctggacaggtccatcccagac
tatcggcccagcaagtgcaaaaacatgttttatcccagagacctgccccagatctctctt
atcttcatctttgtgaacgaggcgctgtcggtgatcctgcgatctgtgcactcggccgtc
aatcacactccacctcatctgctgaaggagatcatcctagtagacgataacagtgatgat
gagcaactgaaagggccacttgaagaatatgtcaacaaacggtacccaggccttgtcaaa
attgtgcgcaatcagaagcgagagggcctcatccgtgctcgtattgagggctggaaaatt
gccacaggggaagtgacaggctttttcgatgctcacgtagaattcactcctgtttgggct
gaaccagttctctccagaattaagcaggaccccaagaggatcgtcctaccctcaatagac
aacattaaacataaatcatttggcctggagcgctacgagaactcaggccatggtttcaac
tgggagctgtggtgcatgtacatcagtcctccaaaacagtggtgggatgagggagacacc
tctgcacccatcaggacccctgcaatgataggctgttcatttgtggcaaaccggcactac
tttggagagttgggtctgctggactcaggcatggatgtctatggtggagaaaacatagag
cttggaattagggtttggctgtgtggggggagtatggaggttttgccgtgctctcgggtg
gctcacgttgccaggacgaagaagccataccacagcaacattgcttttcacaccaggcgc
aatgcactgcgggtggccgaagtatggttggacgagtacaagtctaatgtctacctggcc
tggaacattccaatggagagccatggcattgattatggggacatatcagagcgtgtggca
ctgaggaaaaaattgcagtgtaaaaactttgagtggtaccttgataatatctacccagag
atgaggcgatacaacagcacgctgttttatggagaaattcgcaactccaacgtgacccat
ctgtgtatggatcagggcctaaaggaaaaccacacagcaaccctccacccttgccatgga
tggaacccacagcttggccgctataccaaggagggatacctgtttgtgggacctttggga
agcactggagaagacacctactgtgtgattgatgacatgatcagcagcttccctcagctt
gtcaactgcgacaaagtctctaacataggccaaaagacatggaactttgcacagaatgaa
tcgatcgtgaaccgggccacaggtcgctgcctagaggtggtaaaggccaacgtctccttc
ggctatgcactggttctgcaggcctgcactggccagagatggaacatcaaaaatacgatg
aagcagcagcagggactctga

DBGET integrated database retrieval system