KEGG   Pangasianodon hypophthalmus (striped catfish): 113534430Help
Entry
113534430         CDS       T05759                                 

Gene name
kmt5b
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    113534430 (kmt5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phyp03036]
    113534430 (kmt5b)
Enzymes [BR:phyp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     113534430 (kmt5b)
Chromosome and associated proteins [BR:phyp03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     113534430 (kmt5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 113534430
NCBI-ProteinID: XP_026783026
LinkDB All DBs
Position
Unknown
AA seq 811 aa AA seqDB search
MGESKNMVLNGRRHGSRFSSNQPVGKTRLQNGQRAHLRQSKSSPSGRRCSRRVSGAAPEP
ERRHVPSSGMTAKELCEYDDLSTSLILDSYLGFQTHKMNTRFRPIKGRQSELREVIESFK
KNDNLEKAFQALTSADWRRHHFLNKTKAQEKLFKAHVFVYLRMFAADSGFEILPCNRYSS
EQNGAKIVATKDWKRNDEIEHLVGCIAELSANEEKMLLRHGENDFSVMYSTRKNCAQLWL
GPAAFINHDCRPNCKFVSTGRDTACVKVLRDIEPGEEISCYYGDGFFGENNEFCECYTCE
RRGTGAFKSKAGLPVEVPVINSKYGLRETDKRLNRLKKLEEGSKKSDSQSVASTEAESQE
PTSGQTSLRKRMSQPCLKVHCKGRAVTRQTRPSTHTSTSPPKRSQTTNSSLPKRLKSKPT
QPLSKGRRRRQTGGLKTPTRASVGSLSLKQSCKREADSRGLPQFSGCRGGIKPAADHENN
QNSPKGASACKGSMSCPYRTRRSSRTSLGALERDGGKRGPKPSSTSKVAVSTALKMEPDD
FVPTMPGHQINIPSLEASCPKKGTCPRRRRTIKQEETGTYMDDLLQEGVPDLRHAAHAAD
VADCAKVPLALPERRYEGLAESSKVSRRMKGGKKKRRITRYDAQLILENNTGIPKLTLRR
RHDSSSSKKKEHRDAKAVRRSSKISIKFSKERESERAGLYVAKLNNGFGHGPHGSSTKLK
IQLKREEDVTFTGLVKREEGEVLEREVGVQMGRNIKEDSLTSEDEEDYFDNEDDFIPLPP
AKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgggagaatccaagaacatggtgctgaatggaaggagacatggcagtaggttctccagc
aatcagcccgttgggaagaccaggctgcagaatggccagagggcccacctgcgccagagc
aaaagctcccctagtggcagaagatgcagccggcgtgtcagtggtgcagccccagagcca
gagaggcgccatgtgccctcatcagggatgacggctaaggagctgtgtgaatatgacgac
ttgtccaccagcctgattctggactcttacttgggttttcagactcacaagatgaatacg
agatttcgcccaatcaaaggtcgacagtcggagcttagagaagtgattgaaagcttcaag
aagaatgacaacctggaaaaagctttccaggctttgacctctgcagactggagaagacat
cactttctcaataagacaaaggcccaggagaagctgttcaaagcacatgtctttgtttac
ttgcgtatgtttgcagcagacagtgggtttgagattcttccatgcaatcgctattcctct
gagcaaaatggagccaaaattgtagcaacaaaagactggaaaaggaacgatgaaattgaa
caccttgtgggttgcattgctgagctgtctgctaatgaagagaagatgttgttacgccat
ggagagaatgacttcagtgtcatgtactctacgcgtaagaactgtgctcagctttggctg
ggacccgctgcttttattaatcatgattgccggccaaattgcaagtttgtatccacaggt
cgagacactgcgtgtgtcaaggtcctgcgggacattgaaccaggggaggagatctcatgt
tactatggggatggcttctttggagaaaacaatgaattctgtgaatgctatacttgtgaa
aggcgaggcactggtgcttttaagtcaaaagcaggactgcctgtcgaggtcccagtcatc
aatagcaagtatggcctgagggagactgacaagaggctcaacagactgaagaagctggaa
gagggcagtaagaaatcagacagccagtctgtcgcctctactgaagcagagtctcaggaa
ccaaccagtggacagacatcattacggaagaggatgtcgcaaccctgtctcaaagtgcac
tgcaaaggcagagccgtgacaaggcaaactcggccaagcactcatacctctacctcaccc
cctaaacgaagtcaaacaaccaactcaagtttaccaaagagacttaaatcaaagcctaca
cagcctttgtctaaaggaaggagacggcgtcaaacaggaggactgaaaacgcccaccaga
gcgagtgtagggagcttgagcctcaagcagtcttgcaaaagagaggcggacagtcgagga
ctccctcagttctctggctgcaggggtggaattaagcctgctgcagatcacgaaaacaat
cagaactccccaaagggtgcatcagcctgcaagggcagcatgtcttgtccatacagaact
cgcaggtccagcaggacctctctcggtgctcttgagcgtgatggcggcaagcgtggccca
aagccaagtagcacaagcaaggttgcggttagcacggccctcaaaatggagcctgacgac
tttgttcccacaatgcctggccatcagattaacatccccagcctcgaggccagctgtccc
aagaaagggacatgcccaagacggaggaggacgataaaacaggaggaaacaggcacctac
atggacgatcttcttcaggagggtgtgcctgacctgcgacatgcagcacacgctgctgac
gtggcggattgtgccaaggtgccacttgccctgccagagcggcgttacgaaggcttggcg
gagagttccaaggtgtcacgtcgcatgaaggggggcaagaaaaagcggcgcatcacacgc
tacgatgcacagctgattttagagaacaacacaggcatccccaagctgacactgcggcgg
cggcatgacagcagcagcagcaagaagaaagagcatcgagatgccaaggctgtaagacgc
tcatcgaagatcagcatcaagttcagcaaagagcgggaaagtgagcgtgctggcctgtat
gtggccaagctgaacaacggctttggtcatggacctcacgggagctccaccaagctgaag
atccagctaaagcgcgaggaggacgtgaccttcacaggtttagtcaagagggaggagggt
gaagttctggagagagaggtaggagttcagatgggtcggaacatcaaggaggactcgctg
acttcggaagatgaggaggactactttgacaatgaggatgacttcatccctcttccacca
gcaaaacgtctgcggctcatcgtgggcaaagattccatagatattgacatctcctcaaga
aggagagaggaccagtcactcagacttaatgcctaa

DBGET integrated database retrieval system