KEGG   Pangasianodon hypophthalmus (striped catfish): 113535102Help
Entry
113535102         CDS       T05759                                 

Gene name
sdha
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00020  Citrate cycle (TCA cycle)
phyp00190  Oxidative phosphorylation
phyp01100  Metabolic pathways
phyp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113535102 (sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    113535102 (sdha)
Enzymes [BR:phyp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     113535102 (sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 113535102
NCBI-ProteinID: XP_026784058
LinkDB All DBs
Position
Unknown
AA seq 662 aa AA seqDB search
MAALFATSRVLGKKVLSSKALAPGCPASLRKLHFSIYGKRGDAKVSDAISTHYPVVDHEF
DAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDDWRWH
FYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENFGMPFSRTEDGRIYQRAFGGQSLKYGK
GGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEEGKCEGVIALCMEDG
SIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYG
AGCLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSMTIEIREGRGVGPEKD
HVYLQLHHLPPQQLASRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVI
THKDGEDRVVPGLYACGESGCASVHGANRLGANSLLDLVVFGRACALTIAENNTPGEKLE
PLKPNAGEESVANLDKIRFANGSTRTSEIRLNMQKTMQTHAAVFRTGDVLKEGCVKMDAL
YQTLDDIKTFDRGIVWNSDLVETLELQNLMLNAVQTIHSAEARKESRGAHAREDFKVRVD
EYDYSKPLQGQQKRPFEEHWRKHTLSYTDPKTGKVTLEYRPVIDDSLNDEDCAAIPPAIR
SY
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgctcttcgccacttcccgtgtcctcgggaaaaaggtcttatcatcaaaagct
ttagccccaggttgccccgccagcctccggaagcttcatttctccatctatgggaaaagg
ggagacgccaaagtctcagatgctatatccacacattatccagtggtagatcatgagttt
gacgctgttgtggtgggagcaggtggtgctggactgcgtgctgcgtttgggttgtcagaa
gctggcttcaatacagcgtgtgtcacaaagctgttccccacgcgctctcacacagtggct
gcacagggtgggatcaatgcagcgcttgggaacatggaggaagatgattggcgctggcac
ttttatgacacagtaaaaggatctgattggttgggagaccaggatgccattcactatatg
actgaacaggctcctgctgccgtggttgagctggagaactttggtatgccgttcagccgt
acagaggatggaagaatctaccagcgtgcgtttggaggtcagagtttgaagtacggaaaa
ggaggccaggctcacaggtgctgctgcgtggccgaccggacgggtcactcccttctgcac
acgctgtatggacggtctctgaggtacgacacaagctattttgtggagtatttcgccctg
gacctgttgatggaggaggggaaatgcgaaggagtcatagccttgtgcatggaagatgga
tctattcaccgcttcagggccaaaaacacagtaattgccacaggtggttatggacgcact
tacttcagctgcacatcagcccacactagtacaggagacggtactgccatggtgacgcgt
gccggcctgccctgccaggatctggagttcgttcagttccaccccacaggcatctatgga
gctggttgtctgatcacagagggttgtcgtggtgaaggtggaatcctgattaacagtgaa
ggcgagaggtttatggaacgctacgctccaaacgctaaagacctggcctccagggatgtg
gtttcacgctccatgaccatcgaaatccgtgagggaagaggcgtagggccagagaaagac
catgtgtacctccagctccaccacctccccccccagcagctggcttcccgtctgccggga
atctccgagaccgcgatgatattcgctggcgtggacgtcacgaaggagcccatcccagtc
ttacccacagttcactacaacatgggcggcatccccaccaactacaagggccaggtcatc
acccacaaggatggtgaggatagggtagtgccagggttgtacgcctgcggtgaatccggc
tgtgcctctgtacatggtgccaaccgcttgggagccaactcgctgctggatctcgtggtg
tttggccgtgcgtgtgctctcaccattgccgaaaacaacactccaggagagaagcttgaa
cccctgaagcctaatgcaggagaggaatctgtcgctaacctggacaaaatacgctttgct
aacggctctacaaggacttctgagatcaggcttaacatgcagaagactatgcagactcac
gctgcagtgtttcgtaccggagatgtcttgaaggaaggttgtgttaagatggacgccctg
tatcagacgttagacgacatcaagacgtttgacagaggtatcgtctggaactctgaccta
gtggagactctggagctgcagaatctgatgctgaatgctgtgcagacgatccactcggct
gaggctcgcaaagaaagcagaggggcgcacgcccgggaagatttcaaagtgcgtgtggat
gagtatgattactcaaagccattgcagggtcaacagaagaggcctttcgaggagcactgg
aggaagcacactctgtcatacacagatccaaagacaggaaaggtcactctggagtataga
cctgtgatcgatgactctctgaacgatgaagactgtgccgccattccacctgctatccgc
tcctattaa

DBGET integrated database retrieval system