KEGG   Pangasianodon hypophthalmus (striped catfish): 113535748
Entry
113535748         CDS       T05759                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 113535748
NCBI-ProteinID: XP_026785064
LinkDB
Position
Unknown
AA seq 368 aa
MNIMSLEELIELEELEERIELADSLPPRTPRLERVNALRISPGKFPELWNRVRIIRLLGD
TMKDPQLVEETGEGHDFHPCSHAQPTWCDLCGDFIWGVYKQSLRCANCRFTCHYRCRALI
KLNCNQGDASTTDQSSDVQDSIETDTNVDEVTESKKQELSHSEIQQKIKEYNAQINSNLF
MSLNKDGTYNGFIKVHLKLVRPVSVPPPRKGATSQEPANGKRGGAVKRRTSFYLPKDTAK
HLHISSRTRAQEVIQALLKKFTVIDNPAKFALFERTERHDQVYLRKLPDDECPLFLRLCA
GPNEKVLSLVLKENETGEVNWDAFSLPELHNFLRILKREEEEHVKQIMQRYAVARDRIQQ
ALVSTNPG
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgaacatcatgtcattggaggaactaattgagcttgaggagcttgaggagcgcattgag
cttgctgattctttaccacctcgaactcctcgcctagagagggtcaatgccttgagaata
agcccaggaaaattcccagagctctggaaccgtgtgcggattatcaggctcctgggagac
accatgaaggacccacagctggttgaggagacaggagaaggccacgacttccatccctgt
agccatgctcaacccacctggtgcgatctgtgtggagacttcatctggggggtgtacaaa
caaagcctgcgctgtgccaactgtaggttcacctgccattaccgctgtagagctctcatt
aaactgaactgtaatcagggtgatgcctctactaccgatcagtccagtgatgtccaggac
agcattgaaactgacactaacgtggatgaggtgactgagagcaagaaacaagagctgtcc
cattcagagattcagcagaagataaaggagtataatgctcagataaacagcaacctcttc
atgtctttgaacaaagatggcacctacaacggtttcatcaaagttcatctgaagctggta
cggcctgtgtctgttcctcctccacggaagggtgctacgtctcaggagccagccaatggg
aagagagggggagcagtaaaaaggcgcacgtccttctacctcccaaaggacactgccaaa
catctgcacatcagctctcgaactcgtgcacaggaagtgattcaggcccttctcaagaaa
ttcacagtgatcgacaatcctgcgaagtttgcactgtttgagcgcactgagcgccatgac
caagtgtacctacggaagctgcctgatgatgagtgtccactgttcctgcgtttatgtgct
gggccgaatgagaaggtgctgagtctggtactaaaggagaatgagacgggagaggtcaat
tgggatgcattttctttgccggagctgcacaatttcctgcgcattctgaagcgagaggaa
gaggagcatgtaaagcagatcatgcagcgttatgcagtggctcgtgatcgcattcaacaa
gctctggtcagcaccaaccctggctga

DBGET integrated database retrieval system