KEGG   Pangasianodon hypophthalmus (striped catfish): 113536429
Entry
113536429         CDS       T05759                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04068  FoxO signaling pathway
phyp04110  Cell cycle
phyp04115  p53 signaling pathway
phyp04218  Cellular senescence
phyp04310  Wnt signaling pathway
phyp04340  Hedgehog signaling pathway
phyp04371  Apelin signaling pathway
phyp04510  Focal adhesion
phyp04530  Tight junction
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113536429 (ccnd1)
   04340 Hedgehog signaling pathway
    113536429 (ccnd1)
   04371 Apelin signaling pathway
    113536429 (ccnd1)
   04068 FoxO signaling pathway
    113536429 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113536429 (ccnd1)
   04115 p53 signaling pathway
    113536429 (ccnd1)
   04218 Cellular senescence
    113536429 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113536429 (ccnd1)
   04530 Tight junction
    113536429 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 113536429
NCBI-ProteinID: XP_026786126
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLFCCEVDTIRRAYHDANLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEHTKKTRLQLLGAACMFLASKMKETVPLT
AEKLCIYTDNSIRPCELLQMELLVLNKLKWDLASVTPHDFIEHFLTKLPIHQSAKQILRK
HAQTFVALCATDVNFIASPPSMIAAGSVAAAVQGLYLKGADSSLSSQNLTNYLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQQSNSTESKRVEEDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggagcaccagctgttctgctgcgaggtggataccataagaagagcttaccacgacgcc
aacttgttgaatgatcgagttttacagacaatgctcaaagcggaggaaaactatctcccc
tcgcccaattatttcaaatgcgtgcagaaagaaattgtacccaaaatgaggaaaatcgtc
gccacatggatgctagaggtgtgcgaagaacagaaatgtgaagaggaggttttccctttg
gccatgaactacttggacaggtttctgtctgttgaacacactaaaaagacgcgactgcag
ctgctgggagccgcctgcatgttcttggcctccaaaatgaaggaaaccgtgccattaaca
gctgagaagctttgcatatacacagacaactccatccgcccctgcgaactattgcaaatg
gagctgcttgtactgaataagctgaagtgggatctagcctcggtgacaccacacgacttc
attgaacattttctcaccaaactgcccattcatcagagcgccaagcagatcctgcgcaaa
cacgcacagacgtttgtggctctctgtgcaacagatgtcaacttcatcgcaagccccccc
tcgatgatcgcggcaggaagtgttgccgcggctgtgcagggactctacttgaagggtgcc
gacagttctttatcctcccagaacctcaccaactacctgtcccaagttatcaggagtgac
ccagactgtcttcgatcgtgccaggagcagatcgaatctctgctggagtccagtctgagg
caggcgcagcagcaaagcaattccacagaaagcaaacgcgtggaggaggacgtggatctc
tcctgcactccaacagacgtcagggacattaacatctga

DBGET integrated database retrieval system