KEGG   Pangasianodon hypophthalmus (striped catfish): 113536492Help
Entry
113536492         CDS       T05759                                 

Definition
(RefSeq) transmembrane protease serine 9-like
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:phyp01002]
    113536492
Enzymes [BR:phyp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     113536492
Peptidases [BR:phyp01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   113536492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 Ldl_recept_a DUF1986 SEA DUF1922 Adeno_E3B
Motif
Other DBs
NCBI-GeneID: 113536492
NCBI-ProteinID: XP_026786261
LinkDB All DBs
Position
Unknown
AA seq 786 aa AA seqDB search
MKQQQSKWPKADRPPAPPSTVCRYVTLSTILAILIICALVGVVIAYTVQKEHYFMDTVEL
KGLQYKPELKDKTSAFFLILTATLETKIQNIFLASSFAPHFVSCHIVAYGNISNNVMATL
RLVFRVAKFQVQFTEYTDRFLQEQIQYGFQALVSPNPLTIPEFGEIQSIVLLGASEKSLY
VINANAGRCPDDTFTCASGECVTKPNAECDSVSDCADESDEAYCSCGRKLVVDSRVVGGE
NAQLGDLPWQVSLRLHGHHTCGASIINRHWLVSAAHCFESSKNPRDWTALVGASLVNGVE
KGAITVNIKSLIVSPHYNPMNSDSDVTVLELEKPLTFTPYIQPVCIPSSSHIFSPGQDCI
VSGWGAVKQDSSKLPPTLQKASVKIIDSNVCNSSTVYRGAITNNMMCAGFLQGKVDSCQG
DSGGPLVCESSPDRFFLAGIVSWGMGCAQVNKPGVYSQVTVLRNWILSHADPSSTQDRPT
VHSATNTAVLRAKAVTSTPVVTGAVNCSGNFNCGAGVCISKINPECDRVADCSNEADEKN
CDCGQRPEFSHQRIVGGVSARRGEWPWVASLQFQRLHRCGATLIHCKWLLTAAHCFSRKE
SNPSGWTVSLGSVLRSGVGALIIPVQRIIQHPAFNSSNMDFDVALVQLSIPAPSSYTIQT
LCLPSPTHSFFKGTECYITGWGSMREDGKLTNQLQKAQVGIIDQSECQQSYGRKLTANMM
CAGSMEGGIDTCLGDSGGPLACRQPRGRWFIAGVTSWGRGCARNRFPGVYTRVTAIREWI
STYLPF
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcagcagagtaagtggcccaaggctgatcgtcctcctgctccaccctccact
gtgtgcagatacgttacactcagcaccatcttggcgattctcatcatctgtgctttagtg
ggtgttgtgatagcgtacacggtgcagaaggagcattacttcatggacacggtggagtta
aaaggcctacagtacaaacctgagctcaaggataaaacgtctgcgttttttttaatcctg
acagccactttggaaacaaagatccagaatattttccttgcatcatcatttgcaccccat
tttgtctcctgccatatcgttgcgtacgggaacatcagtaataacgtgatggcgacgctt
cgtttggtcttcagagtggccaaatttcaagtacaatttacagagtacacagaccgtttc
ctccaggagcagattcagtacggctttcaggctttagtcagtccaaacccgctgactatt
cctgagtttggagaaattcagagcatcgtccttctgggtgctagcgaaaagtctttgtat
gtaatcaacgctaatgcaggtagatgtcctgatgacacatttacctgtgccagtggggag
tgtgtgactaaacctaatgctgagtgtgactctgtgtcggattgtgctgatgaatcagat
gaggcatactgctcgtgtggcaggaagctggtggtggacagtcgggttgttgggggtgaa
aacgcccaacttggtgatttgccctggcaggtgagtctgagactccatggccatcacacc
tgcggagcctccatcataaaccgccactggctggtcagtgctgcacactgctttgagagt
agtaaaaacccgagggactggacagcgctggtcggagcgagtttagtgaatggtgtggag
aaaggagcaatcacagtgaacatcaaatctctgattgtctctccacattataaccccatg
aactcagacagtgatgtgactgtgctggagctggagaagccactgactttcactccttac
atccagcccgtctgcatcccatcctcatctcacatcttcagtcctggacaagactgcatc
gtctctggctggggagccgtcaaacaggacagcagcaagttgcctcctacgctccaaaaa
gcctcagtgaagatcattgattcgaacgtgtgtaacagttcgaccgtatacagaggagcc
atcaccaataacatgatgtgcgctggcttcctgcagggaaaagttgactcctgccaggga
gactcaggaggtcctctggtgtgtgaaagcagccctgaccgcttctttctggcgggtata
gtgagctggggaatgggctgtgcgcaagtcaataagcctggagtgtactcccaggtcact
gtgctccgcaactggatcctgagccatgccgaccccagtagcactcaggacagaccaaca
gttcacagcgcaacaaacactgcagtcctccgtgctaaggcagtcacttcaactcctgtg
gtgactggagctgtaaactgcagcggaaactttaactgtggcgcaggagtgtgtatcagc
aagatcaaccctgagtgtgaccgagtcgctgactgctccaatgaagccgatgagaaaaac
tgtgactgtggccagcgacctgaattcagccaccagagaattgtgggaggtgtgagtgcc
cgtcgaggggaatggccatgggtggcgagtctgcagttccagcgtttacatcgctgtggt
gccacgcttatacactgcaaatggctccttacagctgctcattgcttcagcagaaaggag
tcaaaccccagtggctggacggtgagtttaggttcggtgctccggtccggagtgggagct
ttgatcatcccagtgcagaggatcatccagcatcctgccttcaacagcagcaatatggac
tttgatgtggctctggtgcagctctcgatcccggcgccgagctcctacaccatccagacg
ctgtgtttgccctccccaacacacagcttcttcaagggcacagagtgttacatcactggg
tggggctcaatgagagaagatggaaagctaactaatcagttacagaaagctcaggttggt
ataatagaccaatcagagtgtcagcagtcttacggcagaaaactgactgccaacatgatg
tgtgctggatccatggaaggcggcattgatacatgcctgggagattctggaggcccgtta
gcatgccgccagccccggggccggtggttcatagctggggtgaccagttggggtcgaggc
tgtgctcgaaacagattcccgggggtttacacacgtgtcactgccatcagggaatggata
tcaacatacctcccattttaa

DBGET integrated database retrieval system