KEGG   Pangasianodon hypophthalmus (striped catfish): 113537039Help
Entry
113537039         CDS       T05759                                 

Definition
(RefSeq) prostaglandin G/H synthase 1-like isoform X1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00590  Arachidonic acid metabolism
phyp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    113537039
Enzymes [BR:phyp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     113537039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 113537039
NCBI-ProteinID: XP_026787128
LinkDB All DBs
Position
Unknown
AA seq 601 aa AA seqDB search
MKAVSSLLVLWSCTLVQEWSVCTAEEQNSSPTKSVNPCCYYPCQNRGICMRYGLDRYQCD
CTRTGYYGENCTTPEFWSRVYELMKPSPDVIHYILTHFHWIWSLINKTFLRDWLMYKVLT
VRSDLIPSPPTYNSKYGYLNWESYSNTTYYTRILPPVPLDCPTPMGTKGKVELPDPKLLV
EKFLLRREFRPDPQGTNLMFGFFAQHFTHQFFKTHNRMGLGFTKGLGHGVDAGHIYGDNL
ARQLSLRLHKDGKLKYQMINGDMYPPTVAETNVNMHYPALVPPEKQMAIGHEVFGLLPGL
SMYATLWLREHNRVCDILKKEHPTWGDEQLFQTTRLIIIGETIRIVIEDYVQHLSGYQLK
LKFDPSLLFSSRFQYQNRIAVEFNQLYHWHPLMPNSFFIDGTEISYSDFMFNTSTLTHYG
VEKLVQAFSTQPAGQVGGGRNIAHVVAGVAEGVIKESRQLRLQPFNEYRKRFNLKPYKSF
FEFAADKEIARELEELYGDIDAMEFYPALLLEKTRPGAIFGQSMVEMGAPFSLKGLMGNP
ICSPEYWKPSTFGGQTGFDIVNSATLQRLVCLNTKWCPYVSFHVPPPGYQQKKSVDSHAE
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtgagcagtcttctcgtcctgtggtcgtgcactctggtgcaggaatggtca
gtatgcactgctgaggaacaaaactcgtcaccaacaaaaagtgtgaatccttgttgctac
tacccctgtcagaaccggggaatttgtatgagatatggactagaccgctaccagtgtgac
tgcaccagaactgggtactatggggaaaattgcactacccctgagttctggtccagagtc
tatgagctcatgaagccaagtcctgatgttatccactacatcctgacccattttcactgg
atatggagccttatcaataaaaccttcctgagggactggctcatgtataaggtcctcaca
gtgcgatcagacctgattcccagccctcctacctataactcaaagtatggctacctaaac
tgggagtcatattccaataccacttattacacccgaatcctgcctccagtgccactggac
tgtccaacacctatgggtaccaaaggaaaagtggagcttcctgatcccaagctgttggtg
gagaagttcttattgaggcgggaattcaggccagacccccagggtacaaatttaatgttt
ggttttttcgctcagcacttcactcaccagttcttcaaaacacacaatcggatggggctt
ggctttaccaaaggcctaggccatggggtggatgctggacatatctatggagataacctt
gcacggcagctgagtcttagacttcacaaagatgggaagctgaagtaccagatgataaat
ggagacatgtacccacctacagtggcagagaccaacgtgaacatgcactaccctgcgtta
gttccaccagaaaagcaaatggctattggccatgaggtgtttggcctgttgccagggtta
agcatgtatgccaccctgtggctccgtgaacacaaccgtgtatgtgacatcttaaagaaa
gagcatcccacctggggagatgagcaactctttcagaccaccagacttatcattataggt
gagactatccggatagtgatcgaagattatgtacagcacctaagtggctaccagctaaag
ctgaagttcgacccgtccctgctcttcagttcccggttccagtaccagaaccgcattgcc
gtggagtttaatcagctttaccattggcatccactcatgcccaacagcttcttcattgac
ggaaccgagatctcctactctgacttcatgttcaacacctccacgctcactcactatgga
gtggagaaactggtgcaggctttctcaactcagccagcaggacaggttggaggtggacgt
aatatagcacacgtagtggccggagtagctgaaggagtcattaaagaatctaggcaactt
cggctccagccatttaatgagtaccgcaaaagatttaacctgaaaccatacaaatcattc
ttcgaatttgcagctgataaggagatcgcccgcgagttggaagagctctatggagacatt
gacgctatggagttttatccggctttgttgctagagaagacacggcctggtgccatattt
ggacagagcatggtagaaatgggggctccattttccttaaaaggtcttatgggaaacccc
atatgttcacccgagtactggaagcccagcacgtttggaggtcaaactggctttgatatt
gtcaactctgctactctgcaaagactggtttgtctgaatactaagtggtgtccatatgta
tccttccatgttcccccaccaggttatcagcagaaaaaatcagttgactctcatgctgag
ttgtag

DBGET integrated database retrieval system