KEGG   Pangasianodon hypophthalmus (striped catfish): 113539397
Entry
113539397         CDS       T05759                                 

Definition
(RefSeq) nitric oxide synthase, inducible-like
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00220  Arginine biosynthesis
phyp00330  Arginine and proline metabolism
phyp01100  Metabolic pathways
phyp04020  Calcium signaling pathway
phyp04146  Peroxisome
phyp04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    113539397
   00330 Arginine and proline metabolism
    113539397
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    113539397
   04020 Calcium signaling pathway
    113539397
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    113539397
Enzymes [BR:phyp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     113539397
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 113539397
NCBI-ProteinID: XP_026790943
LinkDB
Position
Unknown
AA seq 1079 aa
MGKIIPDTMKEPPLTQTNKVRENRISRCPMSVHMKNFQNGTSHQDTLYHRAVRSQVCKPK
MCEGSIMNPKSLTRSSPVSPPSTNELLTQAIDFINQYYKSFKTSKTDEHLARLNEVANEI
DATGSYQLTTEELAFGAKQAWRNAPRCIGRIQWSNLQLFDARKCRTSKEMFQFLCSHIKF
ATNGGNLRSAITVFPQRTDGQHDFRVWNSQLIRYAGYQMENGRIIGDPANVEFTEICVQL
GWTPKYGSFDVLPLILQANGEDPELFEIPPELVLEVEMEHPQYKWFKELNLRWYALPAVA
NMLLEIGGLEFTACPFNGWYMGTEIGVRDFCDTQRYNILEKVGRYMGLDTHKLSSLWKDE
ALVAINVAVIHSFQKNKVTITDHHSAAESFMKHMETELRLRGGCPADWVWLVPPMSGSLT
PVFHQEMINYILSPFFYYQADPWLTYVWKDETKGLKKRKRISFKALTKAVVFSQILMQSA
LKKRVPCTILYATETGKSQTFAKKLKSMLSCAFNPRLLCMEDYNFQDFKNERLMMVVTST
FGNGDPPGNGETFKKQLMNLNKLQNNMRYCVFGLGSRMYPQFCAFAHAVDDKLAELGAKR
VTSIGEGDELNGQEEAFSAWACNVFKATCEEFGVKGQLSGSESLTETWDAQKHRVQPDSS
TLDYISALSALHSKTVFPMKLKKRKNLQSAASSRSTLLVELEVDDGKEVLNYAAGDHVGV
FPGNSHELVMGILKHLPNAPPTNQSVRLEYLPESGPGGEEWQTDSRIPACSLTEALTFLL
DITTPPSQSFLRKLSQLTKKEDDQQRLLELASDFKCYSEWKAFRKPNFLEVLEEFPSLEL
SAAFLLSQLPLLKPRLYSVSSSPDLYPHELHLTVSVVNYHTQDGKGPLHHGVCSTWLNTL
KEGQTVPCFIHGSGGFHLPPDPTTPAILIGAGSGIAPFRSFWQQRFHDMKKTGLQKSPMM
LVFGCRDADTDHLYKEETFDMKENGTLKSITPAYSRQAGYPKVYVQHVLKKQLSEEVWEV
LNQRSGHVYVCGSMNMARDVAHAIQEILVSHLGITLTQAGEYLDQLKAEKRYHEDIFGA
NT seq 3240 nt   +upstreamnt  +downstreamnt
atgggaaagattattcctgacaccatgaaggagccccccctgacccagacaaataaggtt
agggagaacagaatcagccgttgtccaatgtcagtacatatgaaaaactttcaaaatggt
acaagccaccaagacacactttaccaccgagctgtcaggagtcaggtctgcaagccgaaa
atgtgtgagggttccataatgaacccaaagtctttaacgcgttcttctccagtttcccca
ccttctaccaacgagctccttacgcaggccatcgacttcatcaaccagtactacaaatcc
ttcaaaacgtctaaaacagatgagcatctggcccgtcttaatgaggtggccaacgagatt
gatgccaccggatcttatcagctcaccacagaggagctcgcatttggagccaaacaggct
tggaggaacgcacccaggtgcatcggcaggattcagtggtccaatttacagttgtttgat
gcacgcaaatgcaggacctctaaggaaatgttccagttcttgtgttctcacataaaattt
gccacaaatggaggcaatttaaggtcagcgatcactgtgtttcctcaaagaactgatggc
cagcatgatttccgggtttggaacagtcagctcattagatacgctggctatcagatggag
aacggccgaattataggagaccctgctaatgtggaattcactgagatttgtgtccaactt
ggatggacaccaaagtacgggtcctttgatgtgctgccactgatcttgcaggccaatgga
gaagatcctgagctatttgaaattcccccagagttggtactggaggttgaaatggagcac
ccacagtataaatggttcaaagaactgaacctcagatggtatgcgctgcctgcagtggcc
aacatgttgctggagattggtggtcttgagttcacagcatgccctttcaatggctggtat
atgggcactgagattggtgtgagggacttctgtgatacccagcgctacaacattcttgag
aaagttgggcgttatatggggttggatacacacaagctgtcatcactgtggaaggatgag
gctctggttgccatcaatgttgctgttattcacagttttcagaaaaataaggtgaccatc
acagaccaccactctgccgctgagtccttcatgaagcacatggagactgaattgcgcctg
cgtggtggctgtcctgctgactgggtctggctggtgcctcccatgtctggttctctgacc
cctgtgttccaccaggagatgatcaactacatcctgtcccccttcttttactaccaggct
gatccctggttaacatatgtctggaaagacgagacaaaaggactaaagaaacgaaaaaga
atcagcttcaaagcacttacaaaggcagtggtcttctctcaaatcctcatgcagtctgcc
ttgaaaaagagagtgccttgcaccatcctctatgctactgaaaccggaaaatcacagacc
tttgccaaaaagctcaagtcaatgctcagctgtgctttcaatcccaggctactttgcatg
gaggactacaattttcaggattttaagaatgagcgtcttatgatggtcgtcaccagcaca
tttggcaatggagaccctccaggaaatggagagactttcaagaagcagctcatgaacctg
aataagctgcaaaataacatgaggtactgtgtttttggccttggctctcgcatgtaccca
cagttttgtgcttttgcccatgctgtggatgataagctcgcagagttgggagccaaacgt
gtgacctccataggagagggagatgagctcaatgggcaggaagaggcgttctctgcctgg
gcttgcaacgtctttaaggctacatgcgaagaatttggtgttaagggccaactatcaggc
tctgagtccctaacagagacctgggatgctcagaaacaccgagtgcaacctgacagcagc
accctagactacatctcagccctgtcagcactccactctaaaactgtgtttcccatgaag
ctgaagaagagaaagaatctccagagtgctgcgtcaagccgctctactttactggtggag
ctggaggtggacgatgggaaagaggtcttaaattatgctgcaggtgaccatgtgggcgtt
ttcccagggaattcacatgagctggtgatgggcattctgaagcacctccccaatgctcct
cccaccaatcagagtgtccgacttgaatacctgcctgagtctggccctggaggtgaagaa
tggcagacagattctcgtatcccagcctgctctctaaccgaggctcttacattcctcctg
gacatcaccacaccaccttctcaaagcttcctacgcaagctctcacagttgaccaagaag
gaagatgaccaacagcgcctgctagaactggcatcggacttcaagtgttactcagaatgg
aaagcattccgcaagcccaacttcctggaggttctggaggagtttccttcactggagctc
tctgcagccttcctcctcagccagctacccctgctgaagccccgcctctactctgtcagc
tcctcccctgatctttaccctcacgagcttcacctcactgtgtctgtggtcaactaccat
acccaagatggaaagggtccgctacatcatggtgtctgcagcacatggctcaacaccctc
aaagaaggacagacagttccctgctttattcatggatccggtggattccaccttccacca
gatcccaccactccagctatcctaatcggagcaggaagtggcattgctcccttccgcagc
ttctggcagcaacgcttccatgatatgaaaaagacaggtttgcaaaagagtcctatgatg
ctggtgtttggatgtcgtgatgcagacacagatcatctttataaagaggagacgtttgac
atgaaagaaaatgggactctgaagagcatcactccagcatattctcgtcaagctggttac
cccaaggtgtatgttcaacatgtcctgaagaagcagcttagtgaagaggtttgggaggtc
ttgaaccagaggtccggacatgtgtatgtgtgtgggagcatgaacatggcccgggatgtc
gcccatgctatacaggagatcctggttagccatctgggtataacactcacgcaggctgga
gaatatctggaccaactaaaggctgaaaagaggtaccatgaagacatctttggagcctag

DBGET integrated database retrieval system