KEGG   Pangasianodon hypophthalmus (striped catfish): 113539506
Entry
113539506         CDS       T05759                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04012  ErbB signaling pathway
phyp04068  FoxO signaling pathway
phyp04110  Cell cycle
phyp04115  p53 signaling pathway
phyp04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    113539506
   04068 FoxO signaling pathway
    113539506
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113539506
   04115 p53 signaling pathway
    113539506
   04218 Cellular senescence
    113539506
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 113539506
NCBI-ProteinID: XP_026791076
LinkDB
Position
Unknown
AA seq 164 aa
MCVMMSLPVRGRVLRAVCSGGVEGGVEGGVGGAARRCLFGAVDHEELQRDYMLLMRAELE
GASRRWSFDFITNKPRMGGDFEWVGLPEARVPFLYRDCTVGAEPRPKGAGPASDLEKEDI
PKTPERCDRNTHSAEKHTLKRKQTNITDFYQAKRRVVTTRKSGQ
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtgtgtgatgatgtcactgccggtgcgtggacgtgtgttgcgggcagtgtgtagtggt
ggtgttgagggtggtgttgagggtggtgttggtggtgctgctcggcggtgtttgttcggt
gcagtggatcatgaggagctgcagcgcgactacatgctgctgatgagggcggagcttgaa
ggcgcttcacgccgctggagcttcgacttcatcaccaacaaaccacggatgggcggagac
ttcgagtgggtggggcttcctgaggctcgagttccttttctttaccgtgattgcacagta
ggagcagagcctcgaccaaagggggcggggccagcatccgatctcgagaaggaggacatt
cctaaaacacctgagcgatgcgacagaaacacacacagtgcagagaaacacacactgaag
aggaagcagaccaacatcacagacttctatcaggccaagaggcgagtcgtcaccaccagg
aagtcaggccagtga

DBGET integrated database retrieval system