KEGG   Pangasianodon hypophthalmus (striped catfish): 113539528
Entry
113539528         CDS       T05759                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 DUF5113 C1_2
Other DBs
NCBI-GeneID: 113539528
NCBI-ProteinID: XP_026791131
LinkDB
Position
Unknown
AA seq 370 aa
MSSSMSHWELIELQDLSPEDRIELAPTAGPVGSQKPPERPSLSHTVRLVGDTVRFDVSLW
EKFRRGEGHDFQACGHTHLAWCDLCGEFIWGIYKRSLRCVNCRYTCHSRCRPLIQLDCEA
VLGHSDCSEDIEIDTDVDTVVDWRKQQQLSISELQHKVKEYNAQINSNLYMSLNRDGSYT
GFIKVQFQLARPVSLPPAQRLSSSSSSSSSSSSSSSFCSSFSSLPSHGLCTSFYLPRDTA
KQLHVGSHTRVREVIEALLNKFTVVDNPAKFALFERSERNGQVYLRKLCDDERPLFLRLC
AGPSENALSFILRENETGEVNWDAFSLPELSNFLRILQREEEEHVRQIVQRYSLARDKLK
EALRSFSTPG
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgagctccagtatgtcccactgggagctgattgagctgcaggacctctcccctgaagac
aggatcgagttagcgcccactgctggacccgtgggctcccagaagcccccggagcggccg
agcctgagtcacacggtgcgtctggtcggagacacggtgcgtttcgacgtttcgctctgg
gagaagttcagacggggggaaggtcacgacttccaggcctgcggacacacacatctcgcc
tggtgcgacctgtgtggagagtttatctggggcatctacaaacggagccttcgctgcgtc
aactgcaggtacacgtgtcactcccgctgtcggcccctgatacagctggactgtgaagcc
gtgctcggacactcggactgcagcgaggacatcgagatagacacggacgtggacactgtg
gtggactggaggaaacagcagcagctctccatctctgagctccaacacaaagtaaaagaa
tacaacgctcagatcaacagcaacctctacatgagtctgaaccgggacggctcgtatacg
ggtttcattaaggtccagttccagctggctcggcccgtctctcttcccccagctcagaga
ctgtcctcttcatcctcttcctcatcttcctcttcctcctcttcctctttctgctcctcc
ttttcctccttgccctcgcacggcctctgcacgtcgttctacctgccccgagacacggcg
aagcagctgcacgtcggctcacacactcgggtccgagaggtgatcgaggctctgctcaac
aaattcacagtggtggacaatccggctaaattcgctctgttcgaacgcagcgagaggaac
ggccaggtgtacttgaggaagttgtgtgatgatgagcgtccgctcttcctgcgtctgtgt
gcaggtcccagtgagaacgcgctcagcttcatactcagagagaacgagacaggagaggtg
aactgggacgcgttcagtcttcccgagctcagtaacttcctgcggatcctgcagagggag
gaggaggagcacgtccggcagattgtacagcgctactcactggcacgggacaaactgaag
gaggcgctgaggagcttcagcacgccgggatga

DBGET integrated database retrieval system