KEGG   Pangasianodon hypophthalmus (striped catfish): 113539904
Entry
113539904         CDS       T05759                                 

Gene name
epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113539904 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:phyp04052]
    113539904 (epo)
Cytokines and growth factors [BR:phyp04052]
 Cytokines
  CSF and other factors
   113539904 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 113539904
NCBI-ProteinID: XP_026791809
LinkDB
Position
Unknown
AA seq 193 aa
MDVTGHKERSNTVKRSAGLFALLLIVLEWIRPGLPSPLRPICDLRVLNHFIKEARDAEAA
MKFCKEECSIAVPLTVPLTRVDFDVWEKKNTEEQAQEVQTGLWLLNMAISSVGASITNSA
LHSHIDASVRNIASLKQVLRSLSIQDYVPTVGGTEETWRVSSASELFQVHINFLRGKVRL
LLANAPVCQQHVR
NT seq 582 nt   +upstreamnt  +downstreamnt
atggatgtaactggacacaaggagaggtccaacactgtaaagagatctgctggactcttt
gccttgctgctgatcgtactggagtggattcggcctggcctgccctcccctttgcggccc
atctgtgatctgcgtgttctcaaccacttcattaaggaggcgcgggatgctgaggctgct
atgaagttttgtaaagaggaatgcagtattgctgtacctctcacagttcctctgaccaga
gtggatttcgatgtgtgggaaaagaaaaatacagaggagcaggctcaagaagtccagaca
ggactatggctgttaaacatggccatcagctcagttggtgcatccatcaccaactctgca
cttcactctcacatagacgccagcgtcagaaatatcgccagcctcaagcaggtgttgcgc
agcctcagtatacaggactatgtgcctacagttggtgggacagaggagacatggagagtg
tcttcagcctcagagctcttccaggtccacatcaacttcctgcgtgggaaagtgcgcctt
ttgctcgccaatgcacctgtctgccagcaacatgtcagatga

DBGET integrated database retrieval system