KEGG   Pangasianodon hypophthalmus (striped catfish): 113541559Help
Entry
113541559         CDS       T05759                                 

Gene name
rb1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04110  Cell cycle
phyp04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113541559 (rb1)
   04218 Cellular senescence
    113541559 (rb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:phyp01009]
    113541559 (rb1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phyp03000]
    113541559 (rb1)
Protein phosphatases and associated proteins [BR:phyp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     113541559 (rb1)
Transcription factors [BR:phyp03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    113541559 (rb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rb_C RB_A RB_B DUF3452
Motif
Other DBs
NCBI-GeneID: 113541559
NCBI-ProteinID: XP_026794408
LinkDB All DBs
Position
Unknown
AA seq 907 aa AA seqDB search
MPPKKRSSGGGSGSGSGSGTPPSREAKWSNKKENSVLSPEKHKEKDPEFVALCKDLSVSN
SVCTQAWALWESMTKTVEKVTESNKQLWGACVYISAVDSDDVRFTFTEFQKAVGLSVKQF
LTLVRKLDENVDTISPKVNSAVTRLEKKYEVSLAIYQRFVKTCARIYSVPDEVKRQELLR
CSWILFLLAKGSVLQMEDDLVIAFQLLLCVLEFYIKRCPSSLLQPLYKAAISETTQSPPT
RTSRRNKAKPRPSEMDVQLLEKLCKESDCSVDEVKNVYQSSFCAFLDSMRLSGSQELPAV
ETLSKSYEELYHKSKDFDARLFLVDDETLSPVKAEVTKVEMTPRKNPSGEENVSIPPQTP
IRAAMYSIQQLRGELTSISDQPSGVLMVYFKNCTVDPSEDIVKRVDQLGQTFSQKFAQAV
GQRCEGLGKKRFTLGVQLYYKVMESMLKSEEKRLSVQNFSKLLNNATFHTSLLACALEVV
LATYVGYSLKNGGSESPETDLCFPWILDVFELHAFDFYKVIESFIKAEPTLKHDMIEHLG
RCEQQIMESIAWKSDSLLFELLRQSREDGSGEQAEPPATLNQPLQHNHTAADLYLSPLRP
SRRAAAAAAEADIPVMPPSQPSAPGTKQHRSNSLSLFYKKLYRMAYLRLKMLFSDLLTSH
PELEAIIWTLLQHTLQNEYELMKDRHLDQLMMSAMYAICKVKNVDLRFKTIVTAYKELPN
TNQETFKRVLIRDGQYDSIIVFYNLVFMQRLKTNILQYASPRPPPLSPIPHIPRSPYMYP
SSPLRVPGGNVYISPLKSSRLTPAPMTPRSRILVSIGESFGTSDKFQKINQMVSSTDWPQ
KRSLAGDSNPKPLKRLRFDVDGQDEADGSKSSGESTLDKKLAEMRSVRDRMQEQKMKEEA
EKEDPEP
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaaaagcgcagcagcggcggcggcagcggcagcgggagcggcagcgggacc
cctccgagcagagaggcgaagtggagcaacaagaaggagaactcggtgctctctccagaa
aagcacaaagagaaggatccggagtttgtagccctttgtaaggacctctcagtctccaac
tcggtgtgtactcaggcgtgggcactgtgggaatcgatgaccaagacagtagagaaagtc
accgaatcaaacaagcagctctggggagcgtgcgtgtacatttcagccgtggactcggac
gacgtcagattcacctttacagaatttcagaaggctgttggtctgagtgtgaagcagttt
ctcaccctggtgcgaaagctggatgaaaacgtggacacaataagccctaaagtaaactcg
gccgtgacgaggcttgagaagaaatacgaggtgtcgctggctatctatcagagatttgtg
aaaacatgtgccagaatctatagtgtgcctgatgaagttaagagacaagagcttttgcgc
tgtagctggatcttattcctcttggctaaaggaagtgttctgcagatggaggatgacctg
gtgatagccttccagttacttttgtgtgttctggagttctacatcaagcgttgcccgtcc
tctctcctccagcctctctacaaggcagcaatcagcgagacgacacagagccctccaact
cggacctcaaggcggaacaaggccaagccccgtccttccgagatggatgtgcagttgctg
gagaagttgtgtaaggagagcgactgcagcgtagacgaggtgaaaaacgtctaccaaagc
agtttctgtgctttcctggactccatgcgcttgtcaggctcacaggaacttccagcagtg
gaaactctatccaaaagttatgaagagctctaccataaaagcaaggactttgacgcacga
ctgttcttagttgatgacgagaccctcagcccagtcaaagcagaagttacaaaagtagaa
atgactcctaggaagaacccttctggagaggagaatgtctccattccaccacagacccct
atcagagctgcaatgtattcgatccagcagctgaggggtgagcttacctcaatcagtgac
caaccttcaggcgttctcatggtttacttcaagaactgcactgtggacccctcagaagac
atcgtgaagcgggttgaccagctgggtcagaccttcagccagaaatttgctcaagctgtt
ggtcagcgctgtgaaggactgggcaaaaagagatttactctaggtgtccagctttactac
aaagtcatggagtcgatgcttaagtcggaagagaagagactctcagtgcaaaatttcagt
aaactcctgaacaacgctactttccacacttcactccttgcctgtgcactggaagttgtc
ctggcaacttatgttggatattccctgaaaaatggcggcagtgaatctcccgaaacggac
ctatgcttcccctggatcttggatgtcttcgagcttcatgcctttgacttctacaaagtg
atagaaagtttcatcaaggcggagcccactctgaaacacgacatgatcgaacacttaggc
cgctgtgagcaacagatcatggagagcattgcatggaaatcggattctctcctgtttgag
cttctgaggcagtctcgtgaggatggttccggagagcaagcagagcctcctgcgacgctg
aaccagcctctacagcacaaccacacagcagctgatctatatttgtctcctctgcgtcca
agtcgtcgagctgcagcagcagcagcagaggcagacattccagtcatgcctccgtcacag
ccctctgccccaggcaccaaacagcatcgctccaactccctcagcctcttctacaagaaa
ctgtacagaatggcctacctgcgactgaaaatgcttttctctgaccttctgacctctcac
cccgagctggaggccatcatatggactctgctccagcacacactccagaacgagtatgag
ctaatgaaggacagacacctagaccagctgatgatgtctgccatgtacgccatatgcaag
gtgaaaaatgtggatttgcgcttcaagacgattgtcactgcgtacaaagagcttcccaac
acaaaccaagagactttcaagcgtgtgttgatcagagacggccaatatgattccatcatc
gtcttctacaacctggtgtttatgcagaggttgaagacgaacatcctgcagtacgcttct
cctcggcctcctcccctttctcccattccacatattccccggagcccgtacatgtatccc
agctcccccctcagagtgcctggtgggaacgtctacatctcccctttaaagagcagtcgt
ttgaccccagcacccatgacaccccggtccaggatccttgtatccattggagagtcgttc
gggacctcggacaagttccagaagatcaatcagatggtcagtagcacagactggccccag
aagaggagtctagccggagactccaaccccaaacccctgaagcgcttacgtttcgatgtg
gatggacaggatgaggctgatgggagcaaatcaagcggcgagtctacactagacaagaag
ctggctgagatgcgttcagttcgcgatcgcatgcaggaacagaaaatgaaggaggaggct
gagaaggaagacccagagccctga

DBGET integrated database retrieval system