KEGG   Pangasianodon hypophthalmus (striped catfish): 113541732
Entry
113541732         CDS       T05759                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04010  MAPK signaling pathway
phyp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113541732 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113541732 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:phyp04052]
    113541732 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:phyp00536]
    113541732 (fgf1)
Cytokines and growth factors [BR:phyp04052]
 Growth factors
  Growth factors (RTK binding)
   113541732 (fgf1)
Glycosaminoglycan binding proteins [BR:phyp00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113541732 (fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 113541732
NCBI-ProteinID: XP_026794682
LinkDB
Position
Unknown
AA seq 154 aa
MMEGLITVLAPSPSPFELEQPSYDALKRLYCRNGGQFLRVLAGGAVDGVRQESDAYTVLK
VKAVSTGVVIIRGHEAGRYLAMDRSGKLYGTSLLNDECYFKEKMEENHYNTYSSHKHQEH
GVWYVGIKKNGQMKRGPNTHRGQNAIYFLPIPAQ
NT seq 465 nt   +upstreamnt  +downstreamnt
atgatggagggtctcattacggtcctcgcaccgtcgccatcgccctttgagctcgagcag
ccgagttacgacgctttaaagcggctttactgcaggaacggagggcagtttttacgcgtg
ttagccggcggagcggtggacggcgtccggcaggagagcgacgcgtacactgtgctaaag
gtgaaagcagtgagcacaggtgtggtgatcatcagaggtcacgaggcggggcgttacctg
gccatggacagaagcggaaagctttatggcacttccctgctgaatgacgagtgctatttc
aaagagaagatggaggagaaccactacaacacgtacagttcacacaaacatcaggagcac
ggggtctggtacgtgggcatcaagaaaaacgggcagatgaaaagaggtcctaacacccac
agaggccagaatgcgatctacttcctgcctattccagcacagtga

DBGET integrated database retrieval system