KEGG   Pangasianodon hypophthalmus (striped catfish): 113541807
Entry
113541807         CDS       T05759                                 

Gene name
nr3c1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113541807 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phyp03000]
    113541807 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:phyp03310]
    113541807 (nr3c1)
Transcription factors [BR:phyp03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    113541807 (nr3c1)
Nuclear receptors [BR:phyp03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   113541807 (nr3c1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 113541807
NCBI-ProteinID: XP_026794790
LinkDB
Position
Unknown
AA seq 726 aa
MDCWLNLSNNPAKNTSLGDHPMRGLLQTTGSIVPTSSFSSDVSNGLSSVNVHRELPMGQN
AQEPDSKAFKMQQKPKEGFNLKDNLALLDESIADLNRNSSSENLCFRTADTFTFKMEEFS
SLDKPDYDYVSYDQPEKDESGNERLIEENTLDILQSLELPGSLPDLNEFCVTNDNAFFPS
LAVEDTPLIDSSMLKDIKPVLPGKNINGNDKAHPQQTLEHNLNVPVIKTEKDADFIQLCT
PGVIKQESERRGYCQMTTMAGHPGASVSLSMDSQPYHYGVSTALAHQKPVLDLYGPLPAG
SDGWIQGNGFGDASGMQRANKSVSQPCPSTYTYNSSVLRPEASTSSSSGPARPKGPTRKI
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGWRARQNTHGQHNYLCAGRNDCIIDKIRRK
NCPACRFRKCLQAGMNLEARKNKKLIRLKVQQATAESSSFMASERQSSLVLKSMPQLVPT
MLSLLKAIEPEIVYAGYDSTIPDTSTRLMTTLNRLGGRQVISAVKWAKALPGFRNLHLDD
QMTLLQCSWLFLMSFSLGWRSYQQSNGGMLCFAPDLVINEERMKLPYMSEQCEQMLKITN
ELVRLQVSYDEYLCMKVLLLLSTVPKDGLKSHAVFEEIRLSYIKELGKAIVKRDENSSQN
WQRFYQLTKLLDSMQEMVEGLLNFCFYTFVNKSLSVEFPEMLAEIITNQLPKIKDRSVKP
LLFHQK
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggattgttggctgaaccttagcaataatccagccaagaatacatctttaggagatcat
cccatgagaggcctgctgcaaaccacggggagcatcgtacccaccagctccttttccagt
gacgtctcgaatggactgagcagcgttaacgttcacagagagctaccgatgggacaaaac
gctcaagagcctgacagtaaagccttcaagatgcagcaaaagccgaaggaaggctttaac
ctcaaggataacctcgctcttttggacgagagcatcgctgatttaaaccgcaactcaagt
tcagaaaacttgtgctttcgaaccgctgacacattcacattcaaaatggaggagttttcc
tctttggataaacctgactatgactatgtctcctatgaccagccggaaaaagacgagtct
gggaacgagagactgatagaagagaacacgctggatatcctacagagtctggagctacct
ggctctcttccagacctcaatgagttctgtgtgacaaatgacaatgcatttttcccttcc
ctggcagtggaggacacaccgctcatagacagcagcatgctgaaggatatcaaacctgtt
ctgcctggaaaaaacattaatggaaatgataaagcacatccacagcagactctggaacat
aacctcaatgttcctgtcataaagacagagaaagacgcagattttattcagttgtgcaca
cctggtgtgatcaagcaagaaagtgagaggagaggctactgtcagatgacaacaatggct
gggcatcctggagcgtccgtcagtctgagcatggacagccagccgtaccactacggagtc
agtaccgctttagcacaccagaagccggtactggacttgtatggccctttgccagctggc
agtgatggctggattcagggaaatggatttggagatgcatcagggatgcagagagccaac
aagtctgtgtctcaaccatgtccttccacctacacatacaacagttctgtgctgaggcct
gaagccagcacttcaagctcatctggtcccgctcgacccaaaggcccgaccagaaagatc
tgcctggtgtgttcggacgaggcgtcagggtgccactacggcgttctgacctgcggaagt
tgcaaagttttcttcaaaagagctgtagaaggatggagagcacgacaaaacacacatggc
caacacaactatctgtgcgccgggagaaacgactgcatcatcgacaagattcgcaggaag
aactgtccagcctgccgctttcgcaaatgcctccaagcgggcatgaacctagaagcacgc
aaaaacaaaaagttgatccgactaaaagtgcagcaggctacagctgagtcctcgtccttc
atggccagcgagcgtcagtcctctctggtgctcaagtccatgcctcagctcgtacccacc
atgctgtcactgctaaaggccatcgagcctgaaattgtgtacgctggctatgacagcacc
atccccgacacctccacacgcctcatgaccaccctgaaccgtctcggcggacgccaggtc
atctccgccgtcaagtgggccaaagccctgccaggtttccggaatctgcacctggatgac
cagatgaccctgctgcagtgctcctggctgttcctcatgtccttcagcctcggctggaga
tcgtaccagcagtccaacggaggcatgctctgcttcgcccctgaccttgtcatcaatgag
gagaggatgaagctgccctacatgagtgaacagtgtgagcagatgctgaagatcacgaac
gagctggtgcggctccaggtctcctatgacgagtatctctgtatgaaggtgctgctgttg
ctcagtacagtgccaaaggacgggctgaagagccatgctgtgtttgaagaaatccgcttg
tcctacattaaagagctgggcaaagccatcgtcaaacgggacgagaactccagccagaac
tggcagaggttctatcagctcactaagcttttggactccatgcaggagatggtggaggga
ctgctcaatttctgcttctacacgtttgtgaacaagtccctgagcgtggagtttcccgag
atgctggctgaaatcatcaccaaccagcttccgaaaatcaaagatcgcagcgtcaagcca
cttctctttcatcaaaaatga

DBGET integrated database retrieval system