KEGG   Pangasianodon hypophthalmus (striped catfish): 113542194Help
Entry
113542194         CDS       T05759                                 

Gene name
hk1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00010  Glycolysis / Gluconeogenesis
phyp00051  Fructose and mannose metabolism
phyp00052  Galactose metabolism
phyp00500  Starch and sucrose metabolism
phyp00520  Amino sugar and nucleotide sugar metabolism
phyp00524  Neomycin, kanamycin and gentamicin biosynthesis
phyp01100  Metabolic pathways
phyp01200  Carbon metabolism
phyp04910  Insulin signaling pathway
Module
phyp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
phyp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113542194 (hk1)
   00051 Fructose and mannose metabolism
    113542194 (hk1)
   00052 Galactose metabolism
    113542194 (hk1)
   00500 Starch and sucrose metabolism
    113542194 (hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    113542194 (hk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    113542194 (hk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    113542194 (hk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phyp04131]
    113542194 (hk1)
Enzymes [BR:phyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     113542194 (hk1)
Membrane trafficking [BR:phyp04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    113542194 (hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 113542194
NCBI-ProteinID: XP_026795351
LinkDB All DBs
Position
Unknown
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYSMRFSDETLRDIMTRFRMELEKGLSRDTNATAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQIYETPEDIMH
GSGTRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCVQTKLDEAVLLTWTKRFKASGV
EGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGMIIGTGTNACYME
ELRHIDVVEGDEGRMCINTEWGAFGDDGMLEDIRTEFDRDIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKIETKHVSAIEKSKEGLTKAKEILTRLG
VEPSSDDCIAVQHVCAIVSFRSANLIAATLGAILTRLKDNKNVPRLRTTVAIDGSLYKMH
PQYARRLHKTVRRLIPECDVRFLLSESGSGKGAALVTAWASRLADQTRQIAETLAEFHLS
KEQLLEVKKRMHTEILNGLSKKSQGTATVKMLPTYVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPVEVMQGTGEELFDHIVTCISDFLDYMGMKNARLPLGF
TFSFPCRQTSLDAGILVNWTKGFKATDCEGEDVVNLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIAGTGSNCCYMEEMRNIETVEGDEGRMCVNMEWGAFGDNGCLDD
IRTQYDQNVDDLSLNPGKQRYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCGAVSRRAAEICGAGMAA
IVDKIRENRSLDHLDITVGVDGTLYKLHPHFSRIMHQTVKELAPKCNVNFLLSEDGSGKG
AALITAVGCRLRQQEQKN
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgatagccgcacagcttctggcctactacttcactgaactgaaggatgatcaggtcaaa
aagattgataagtacctgtactccatgcgcttctctgatgagacactgcgagacatcatg
acccgtttccgtatggagctggagaaagggctgagccgtgacaccaacgccacagccact
gtcaagatgctgcccacctttgtcaggtccatccctgacggatcagaaaagggggatttc
attgctctggatctgggaggctcaaatttccgaatcctgcgagtgaaagtttctcatgaa
aagaagcaaacagtgcagatggagagtcagatctatgagactccagaagacatcatgcat
ggcagtggaacacggctatttgaccatgttgctgaatgtctgggggactttatggagaag
caaaagatcaaggataagaaacttccagtgggattcaccttctctttcccttgtgttcaa
accaaactggatgaggctgttttgctgacctggacaaaacgtttcaaagccagtggagtg
gaggggatggatgtggtgaagcttctgaacaaagccattaaaaagcgaggggactatgaa
gctgatatcatggcggtggtcaatgacactgtgggaaccatgatgacctgtggctttgat
gaccagcgctgtgaagttgggatgatcattggtacaggcactaacgcgtgctacatggag
gagttgaggcatattgacgtggtggagggagacgagggaaggatgtgcatcaacacagag
tggggagctttcggagatgatggcatgctggaggacattcgcactgaatttgatcgagat
atcgaccgtggatccctcaaccctggcaaacaactgtttgagaagatggtgagtggaatg
tacatgggggagctggtgaggctcatcctagtgaagatggccaaagaggggctgttgttc
gaaggccgcatcactccagagctactgactaaaggcaaaattgaaacaaagcatgtttct
gctattgagaagagtaaagagggattgaccaaagccaaggaaattttaacccgtctggga
gtggaaccatcatcagatgactgcatcgccgtgcagcatgtgtgtgctatcgtctctttc
cgctcagccaatctcatcgctgctacactgggtgctatcctcactcgcctgaaggacaac
aagaatgtccctcgtctccgcactactgtagccatcgatggctcactctacaagatgcac
ccgcagtatgcccgtcggctccataagactgtgcgacgtctgatacctgaatgtgatgtc
cgattcctgctctcagagagtgggagtggcaaaggtgctgccttggtaacagcctgggcc
tctagattggctgatcagacacgccagattgccgagacactggcggagttccacctgagc
aaagagcagctgctagaggtgaagaagaggatgcacacagagatcctgaacggcctgagc
aagaagagccagggcacagctacagtgaagatgctgcccacttacgtgcgcagcacccca
gatggcacagaaaatggagacttcttggctttggaccttggaggcacaaactttagggtg
ctcttagtgaagattcgcagtggtaagagacggactgtggagatgcataacaaaatctat
gccattcccgtcgaggtgatgcagggaacaggagaagagctttttgatcacattgtcacc
tgcatatcggacttcctggactacatgggaatgaaaaatgcaaggcttcctttgggcttc
actttctcgttcccctgtagacaaaccagccttgacgctggcatcctggtaaactggacg
aagggctttaaggccacagactgtgaaggagaggatgtagtcaatctcttaagagagggg
attaaaaggagggaggagtttgacttggatgtcgtggcagtggttaatgacacagttgga
actatgatgacttgtgcttatgaggaaccaacatgtgaggtcggccttattgcaggaacg
ggcagtaattgctgttacatggaagaaatgaggaacattgagacagtggagggagatgag
ggcaggatgtgtgtgaacatggagtggggtgcatttggggacaacggctgcctggatgac
atcaggacccagtatgaccaaaacgtggatgatctctccctcaaccctggcaaacaaagg
tatgagaagatgtgcagcgggatgtacctgggtgagattgtgcgaaacatcctcattgac
ttgacaaagcgtggcttcctcttcaggggtcagatctcagagactctcaagactaggggc
atctttgaaaccaaattcctgtcccagattgagagtgaccgtctggcgctactgcaagtc
agatctatcctgcagcacttgggtctggacagcacgtgcgacgacagtatcatcgttaag
gaagtgtgtggtgctgtgtcacgccgagctgcagagatctgcggtgcgggaatggctgct
attgtggacaaaatccgagagaaccgaagcctagatcatctggacatcactgtcggggtg
gatggcacgctttacaaactccatccacatttctcccggataatgcaccagactgtgaag
gaacttgctcccaagtgcaatgtgaatttcttgctctctgaagatggaagcggaaaaggt
gctgcgctgatcactgctgttggatgccgcctacgtcagcaagaacaaaagaactga

DBGET integrated database retrieval system