KEGG   Pangasianodon hypophthalmus (striped catfish): 113542507Help
Entry
113542507         CDS       T05759                                 

Gene name
setd2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    113542507 (setd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phyp03036]
    113542507 (setd2)
Enzymes [BR:phyp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     113542507 (setd2)
Chromosome and associated proteins [BR:phyp03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     113542507 (setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW AWS
Motif
Other DBs
NCBI-GeneID: 113542507
NCBI-ProteinID: XP_026795893
LinkDB All DBs
Position
Unknown
AA seq 2669 aa AA seqDB search
MDALLNPELREKTLDGSIKVENTSKQVIFKGLAPRVVLTNHLLPKGTKTKVNLEEQGRQK
VSFSFTQSKKPRQKVFLVPPSPEKAASEISPAVQSTNLPSADLTGQSAESKNEQIDPSVV
ATAVAESQPTHSPVPLTSKPKHDRVHFKKQILSVSVVEERPTVSDVLNDTTSETEVLIRS
SAKIEGEPSVALFQHDSVTDCSEKVNIEEGAQEKLDTRLKGPTDSSHIGKECKDSISEPE
HSKNVRQSDHILPGSDFDGESVRTSSTQKTSDSKNVAKCDSQSAVVKKSSSSRNEVSDKS
RSDKREEKDEKGSSRCKSDRDTRHTSSRSSRSDRRRTKSRSRSRSRSSRTSSSYSRSERS
RNERQSRSDRSHYHDSERRAHRSSRERRRSRSRGDGRSRDSSDSEDDLRKPRTRGSDSSR
SSTYSSSQRDSKTSSNSKSYRDSKSSPHSSESDKRTQYSRTERSGRTGGSEPSKRSSPET
ETSHKKSSSHSKSEVHGKTSNSNNMSRSEKKVQKTSGSSDSDDEHKTKTRFQGSDRSVRL
SVKKTNNSESKSSNIGTDGQLVAKVNINAKLPHLGSDKIKSQGEFNKVDVCSQHEESRQS
KLTNNSSQQKQQVILKDSLKSHVEFQGVNKDSNVTEKWPAISEVNISKCQVTLKDISLED
DQLGKQTDILIQNKVQILKEAQTSVANVGTFFKTNDSSSLNEPLYPGYAPSQDSLGSLAD
TLSVKELPPGECLKPNTKFVSQLLLSNEVSRLPMNVETSQKVTEQSDMKPKQTNAAVIKH
VKKSRWDIVGQDTAENQTPQKNETSSVKKVISVKKIEFNNDASHEEKCSKKEKSMMDSLK
SELDEETDKATMDSEKEIKQDPEQEPFAVDAQQASDKGSDHVADQSLANQVTLKPNCSPC
AVIHIDQKYANSDKLNSDDSYKPLTQECVSFNCDGKSHSEESETDDSDSDSDDGQVSLKR
LHSVVVVPKNSTITLETTDQPTPPASPSALSGQLTYQADELSISINSEISKNLNTPITPK
PVECSAEGSKHNILSVAENKCMPSVQMPYQSQSDFVDSTSQSEATTTLAHTERNCTVKER
PKTCVPIDQVPTYTQREAESGCHRYHDNPDSWHGRKGGREQFGDFSCTDDLRPQNGLNLA
CDFTQTEQPSSTFQQPDSSHSTQQPSQIGSAFTRQDSGYWTQAKVSDKSMSVNTLVPSLC
HETVCQIHPDSLTNDHEEDYEGKAFGLGGGVIPSRKPPASAFVQANEISSNCSFVTATAE
SQIISEPPREGSQKPHRGRGPPKKRRPELESESDNEAEAGLACKRECLEERERFKDTKET
KISSQQEEQRPLLSLKEFLDPAFWKEKAKLKMMPPYFDLIEENVYLTERKKNKSHRDIKR
MQCECAVLSREERAQGVMACGEDCLNRLLMIECSSRCLNGVYCSNRRFQMKQHADFEVIL
TESKGWGLRAAKDLQPNTFVLEYCGEVLDHREFKSRVKEYARSKNVHYYFMALKNNEIID
ATLKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKAVKAGTELTFDYQFQRYGKEAQ
KCYCGAPSCRGFLGGENRVSVRAAVGKKQRERSRKKEAVSALTTVDEELEALLENGEGLS
DEKQVVSLCRLMVRVETMEQRLTCVKLIQNTSNSSCLKQFLDHHGLSLLWIFMVDLSEAK
SNSVNNIKLQMEIMKALAVLPISTKNMLEESRVLQYIQRWAQSHQLCQPTEQDGYSSEST
SRAHTPLNTPDGPPAKLAPELDGDTPKRAVYRRLKIISENSLDSALSDGSKVSDGKEEED
EEEEEVEEEPSQEVTADTAEKKETSEEMAVTPEPLVKQEASDAVESSQAKLEIKEEDVEQ
DKTEAQETEEKPTSKTDENLPALMEENSESEPAEIKTQVQTPAIDQPHDAASGKAEEDAS
PSIHPPDESTPSSESSSENESTEPSVTNIMAPSTISSAPTEPLDVNTPSDGMETTPSEST
VNQESSPPNLDNIPPSSGASSAEKTSAEVSAVTVESSPSVSAVGTVELLPLGIVATEGTV
VGTPSQDEEEAVSDVESERSQEPQIGAADISEMATRLLDSWKDLKEVYRIPKKSQAEKDS
NDRSRDREALLTPRTSSSSRERERDRDRERERERDWDRDRDWDREKDSDRSLLRSAERRR
RRGSASPPYPSPYERSSRRNEDRYDSSSSKKPRTKEARTKLSTEERRKLFEQEVAQREAQ
KQQQQQQQQQQQQQQQQLQRLAFNPLVYPSSPGFMTYPPGYPIQTYVDPSNPNAGKVLLP
TPPMEPLCVTPAGTVSFDQTTQPLISDLTLAAQSPSTTQASSATSLAHVPATLELASSAQ
PQQFVQPAAQAQDPGVTVLSVPTQTAGTQVQGQQGYATLWDPNTQQAVTVQPAQQYSNTA
QPQTAIYYQGQPCQTIYSIPAGYPQTNTPVIQTYTEPATAYLQGQQVYAGHQQGVVVQQG
GTVTTIVTSQTVQQEMIVPNNIMDLPPPSPPKPKTIVLPPSWKVARDPEGKIYYYHIVTR
QTQWDPPSWDGVGEEASVEHEAEMDLGTPTYDENPSKFSTKTAEADTSSELAKKSKEVFR
KEMSQFIVQCLNPYRKPDCKLGRISNTEDFKHLARKLTHGVMNKELKSCKNPEDLECNEN
VKHKTKEYIKKYMQKFGAVYRPKEDAEVE
NT seq 8010 nt NT seq  +upstreamnt  +downstreamnt
atggatgcactgctgaatcctgaactcagggaaaagacacttgatggttcgatcaaggtt
gaaaacacctcaaagcaagtcatatttaaaggccttgctcctagagttgttttaacaaac
catctcctgcctaaaggaacaaagactaaagtgaaccttgaggaacagggtcgacagaag
gtctctttcagcttcacccagtctaagaagccacgccagaaagtgttccttgtcccacca
agtccagagaaagctgcaagtgaaatttctcctgcagtgcaatctacaaatctgccctct
gcagacctaacaggacagagtgctgaaagcaagaatgagcaaattgatccctctgttgtg
gccacagctgtagctgagtcccagccgacacactccccagtacccctcacctccaaaccg
aaacatgacagggtgcattttaagaaacagattctgagtgtatctgttgttgaagaacgt
cccactgtcagtgatgttttaaatgataccacctcagagaccgaagttttaattagatct
tcagcaaagattgaaggtgaaccctctgtggctctgttccaacacgactctgtcactgac
tgttctgaaaaagttaacatagaggaaggtgctcaggagaaattagacactcgtcttaag
ggaccaactgattcctcccatattgggaaagagtgtaaggatagtatttctgagcctgaa
cacagcaaaaatgtccgtcagtccgaccatatcctgccaggttctgactttgatggcgag
tctgttcggacatcatctacccaaaagactagtgattccaagaatgtggcaaagtgtgat
agtcagagtgctgttgttaagaagtcctcgagctccagaaatgaagtctcagacaaatcc
agatctgataagagagaggagaaagatgaaaaagggtctagtcgatgtaaatcagataga
gacactagacacacatcctcacgatcttctcgttctgaccgaaggaggaccaagagtcgg
tcacggtctagatcacgaagttctcgaacaagttcttcctactccagatctgagagatca
agaaatgaaagacagtcaaggtcagataggtcacattaccatgattccgaaaggagagcc
cacagaagttcacgtgaacggaggaggtcccgctcacgaggtgatggcagatctcgggac
agctctgactctgaagatgacctcaggaagcccaggactcgaggcagtgattcaagccgg
tcctccacatactctagctcacaaagagattcaaagacatcctctaattcaaaatcctac
agagactcaaaatcttctcctcattcatcagaatcagacaaaagaacacaatactcaaga
acagagagatctgggagaactggtggctctgaacctagtaaaaggagttctcccgagact
gaaaccagtcacaaaaagtccagttcccactcaaaatcagaggtacatggtaaaacatcc
aattcaaataacatgtcaaggtctgagaaaaaggtccaaaaaaccagtgggagttctgac
tctgatgatgagcacaaaacgaaaactcgatttcaaggctcagaccggtctgttaggtta
tctgttaaaaaaactaataattcagagtcgaagtcaagtaatattggaacagatggacaa
ttagtagcaaaagtaaatattaatgctaaacttccacacttgggttctgacaaaatcaag
tctcagggagaattcaacaaggtggatgtttgttcccaacatgaagaaagcaggcagtct
aaattaacaaataattcttcccaacaaaagcagcaagttatcctaaaggacagtttaaaa
agtcatgttgaatttcaaggtgtaaacaaagattccaatgttacggaaaagtggccagct
atcagtgaagtaaatattagtaaatgtcaggttactctcaaagacatttctttagaggat
gatcaacttggaaaacagacagacattctaattcaaaataaagtacagatcttgaaagag
gcacagactagtgtggcaaatgttggtacctttttcaaaactaatgattcttctagcttg
aatgagccactttatccaggctacgcccccagtcaggattcattaggttcattggcagac
actctttctgtgaaagaattaccacctggagaatgcttgaaacctaacactaaatttgtt
tcccagttgcttctcagtaacgaagtcagtagactgcccatgaatgtcgaaacctctcaa
aaagtaactgagcagtcagacatgaagcctaaacagactaatgctgcagttataaaacat
gttaaaaagtcgcggtgggatattgttggtcaagacactgcagaaaatcagaccccccaa
aagaatgagacttcctctgtgaaaaaggtcatttcagttaagaaaatagaatttaacaat
gatgctagtcatgaagaaaaatgctcaaagaaagagaaatctatgatggattcactaaag
tctgagttggacgaggagacagacaaggcaacaatggattctgagaaagaaatcaagcaa
gatcctgagcaagagccatttgctgttgacgcacaacaagccagtgataaaggtagtgat
catgtagctgaccaatccctggcaaatcaagttactctgaaacctaattgcagtccatgt
gctgttattcatattgatcagaaatatgccaattctgacaaattgaacagtgacgactca
tataagcctttgactcaagagtgtgtgtcgttcaattgtgatggtaaaagccacagtgag
gaaagtgaaactgacgactccgactccgactcagatgatggacaggtctctttgaagcgg
ctgcactctgtggtggttgtgccaaagaattctactattacccttgagacaactgaccag
ccaacaccaccagctagcccatcagctctctctgggcaactaacttatcaggcagatgag
ttgagtataagcattaacagtgagatttctaaaaatctcaacactccaatcactccaaaa
cctgtagaatgttcagctgaaggaagcaaacacaatatcttgtcagttgctgagaataaa
tgtatgccttctgtgcaaatgccctaccagtcccagagcgacttcgttgacagcactagc
cagtctgaggcaaccacaacactggctcacacagaacggaactgcactgtcaaagaaaga
ccaaagacttgtgtcccaatcgaccaagtacctacctatacgcagagagaggctgaatca
ggttgtcaccggtatcatgacaatccagacagctggcatggaagaaagggaggaagggaa
caatttggagatttcagttgcacagatgatctcaggccccagaatggtttgaacctggct
tgtgacttcacccaaacagagcagcccagcagcacatttcagcagccagacagcagtcac
agcactcaacaaccgtcgcagataggaagtgcatttaccaggcaagatagtggttactgg
acccaggcaaaagtctctgataaaagcatgtcagtcaatacacttgtgccttctctttgt
catgagacagtgtgccagattcaccctgactctttaactaatgaccatgaggaagattat
gaaggaaaagcctttggacttggtggtggagttataccatctagaaaacctccagcatca
gcgtttgtccaagccaatgagataagcagcaattgcagctttgtaacagccactgctgag
agtcagatcatctcagagcctccaagggaaggcagccaaaagcctcatagaggcagaggt
ccacccaagaaaagacgaccagaactggagtcagaatcagacaatgaggcagaggcaggt
cttgcttgtaagcgagaatgcttagaggagcgcgagcgcttcaaggatacgaaagagacc
aagatatcctcacagcaagaagaacaacgtccactgcttagtctgaaagaatttttggat
cctgctttctggaaggaaaaagctaagcttaaaatgatgcctccttattttgatctcatt
gaggaaaacgtctacctgacagaacgcaagaagaataagtctcatcgagatattaagcga
atgcagtgtgagtgtgctgtcctttcaagagaggagcgggcacagggagttatggcttgt
ggagaagattgtttgaatcgcctgctgatgattgaatgctcatcacggtgcttaaatgga
gtatattgctcaaaccggcgctttcagatgaagcagcatgcagattttgaagtaattctc
actgaaagcaaaggctggggtttgcgggctgccaaagacttacagccgaacacatttgtg
ttggagtattgcggtgaggttctggatcacagggagttcaagtcacgggtaaaagagtat
gctcgcagcaagaatgtccactactacttcatggctttgaaaaataacgagatcattgat
gccacactgaaaggcaactgctcaaggtttatgaaccacagctgtgagcccaactgtgaa
actcagaagtggacagtgaatggtcagctcagagttggcttctttaccaccaaagctgtg
aaggctgggacagagctcacttttgattatcagttccaaagatatgggaaagaggcacag
aagtgttactgtggagcaccgagttgccggggcttcctgggtggggagaatcgcgtcagt
gtacgggcagcggtggggaagaaacaaagggagcggtctcggaagaaagaagctgtcagt
gcactgactacagtggatgaggagctagaggctctgctagagaatggggaaggtctgagt
gacgagaagcaagtggtttcactctgcagactgatggtgcgtgtggaaactatggagcaa
agactcacttgtgtgaaactcatccagaatacttcaaattcttcatgcctcaagcagttt
ttggatcatcatggtctctcattgttgtggatattcatggttgatctctctgaagccaaa
agcaactctgttaataacatcaaactgcagatggagataatgaaggcattagcagtgttg
cccatttctactaagaacatgctggaagagagccgtgtgctgcaatacatccagcgctgg
gcccagagccatcagctttgccagcctacagagcaagatggttactccagtgagagcacc
tccagagcccacacacctctcaacaccccagacggccccccagccaaactggcgccagag
ctggatggagacactccaaaacgtgctgtctaccgcaggctgaagatcatcagtgagaac
agcctggatagtgcgctctcagatggaagcaaggtctctgatggtaaagaggaagaagat
gaggaagaggaggaggtggaggaggagccctcacaggaggtgacagcagacacagcagaa
aaaaaagagaccagcgaggagatggctgtgaccccagagccactagtgaaacaggaagct
tcagatgctgtggagagtagtcaagcaaaactagagataaaggaggaggatgttgagcag
gataaaacagaagcacaggaaactgaggagaaaccaactagcaagacagatgagaatctg
cctgctctcatggaggagaacagtgaatctgagcctgcagaaataaaaactcaagtgcag
acacctgcaatagatcaacctcatgatgctgccagtggcaaagctgaagaagacgctagc
ccctctatacatccccctgatgagagcactcccagctctgagtcttcttcggagaatgag
agcactgagccttcagtcacaaacatcatggctccttccaccatcagcagtgcacctaca
gaaccccttgatgtcaacacgccttcagatggtatggaaactacaccttccgagtctaca
gttaaccaagaatcttcacctcccaacttggataacattccacctagttctggtgccagc
tctgcagagaaaacatcagctgaagttagtgctgttactgtggagagtagtccttcagtt
tcagctgttggcacagtagagttgctgccactggggatagtggcgacagagggcacagtg
gtgggcacaccttcccaggatgaggaggaagctgtatctgatgtggaaagtgagagaagc
caagagcctcagattggagctgctgacatcagtgagatggccacccgcctacttgacagc
tggaaagacctgaaggaggtgtacaggatcccaaagaagagtcaggccgagaaagactct
aatgaccgcagtcgggacagggaggcactgctgacaccccgcacctcctccagcagccgt
gagagagagcgggacagagacagagagcgggagagagagcgggactgggaccgagatcga
gactgggaccgagaaaaagactctgacaggtcattgctacgcagtgccgaaaggcggcgt
agacgaggctccgcctctcctccatacccatctccctatgaaaggagcagccgcagaaat
gaagaccgctatgattcatccagcagtaagaaacctcgaaccaaggaggctcgtaccaag
ctttcaacagaggagcgaaggaagctctttgagcaggaggtggctcagcgagaagcccag
aaacaacagcagcagcagcagcagcaacaacaacagcaacaacaacagcagctacagaga
ctagctttcaatcctcttgtgtatccctcaagcccaggcttcatgacctatccacctggc
taccctattcagacgtatgtggacccatctaaccccaatgcaggcaaggtgctattacct
acaccgcccatggagcctctgtgtgtgactccagccggcacagtttcctttgatcagact
actcagccgctcatttctgacctgactctggcagctcagtcccccagcaccactcaggcc
agctcagctacaagtctggcacatgtgcctgctacactggagctggcatcatctgcccag
ccacagcagtttgtccagccagccgcacaagctcaggaccctggcgtcactgtcctgtca
gttcctactcagacagctggcacccaagtgcagggtcagcagggctatgcaacactttgg
gatcccaatacacaacaggcagtgaccgtgcagcctgctcagcagtactcgaacacagcc
cagccacagactgccatctattaccaaggccaaccatgccagacaatctacagcattcct
gcaggttacccacagaccaacactcccgtcattcagacatacaccgagccagccactgcc
tacctacaggggcagcaggtctacgctggtcaccagcagggagtggtggtccagcaaggc
ggcacagttaccaccatagtcacgtctcaaactgtacagcaggaaatgatcgtacccaac
aacatcatggacctgcctcctccttcacctcccaaacctaaaaccattgtcctgcctccc
agctggaaggtagcacgggatcctgagggcaagatctactactatcatatagtcaccagg
caaacccagtgggatcctcctagttgggatggagttggggaagaggccagtgtggagcat
gaggctgagatggacttggggacaccaacatacgatgaaaatccctcaaagttttccaca
aagacagctgaggcagacacctccagtgagcttgcaaagaaaagtaaagaggtcttccgc
aaagagatgtcacagtttattgtccaatgccttaatccgtaccgaaagcctgactgcaaa
ctgggccgcattagcaacactgaagatttcaaacatcttgccaggaagttgactcatgga
gtgatgaacaaggagctcaaatcctgcaaaaacccagaggacctagagtgcaacgagaac
gttaaacacaagaccaaggaatacattaagaaatacatgcagaagtttggagctgtttac
cggcccaaagaggacgcggaggtggagtag

DBGET integrated database retrieval system