KEGG   Pangasianodon hypophthalmus (striped catfish): 113542536Help
Entry
113542536         CDS       T05759                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00010  Glycolysis / Gluconeogenesis
phyp00053  Ascorbate and aldarate metabolism
phyp00071  Fatty acid degradation
phyp00280  Valine, leucine and isoleucine degradation
phyp00310  Lysine degradation
phyp00330  Arginine and proline metabolism
phyp00340  Histidine metabolism
phyp00380  Tryptophan metabolism
phyp00410  beta-Alanine metabolism
phyp00561  Glycerolipid metabolism
phyp00620  Pyruvate metabolism
phyp01100  Metabolic pathways
Module
phyp_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113542536 (aldh2)
   00053 Ascorbate and aldarate metabolism
    113542536 (aldh2)
   00620 Pyruvate metabolism
    113542536 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    113542536 (aldh2)
   00561 Glycerolipid metabolism
    113542536 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    113542536 (aldh2)
   00310 Lysine degradation
    113542536 (aldh2)
   00330 Arginine and proline metabolism
    113542536 (aldh2)
   00340 Histidine metabolism
    113542536 (aldh2)
   00380 Tryptophan metabolism
    113542536 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    113542536 (aldh2)
Enzymes [BR:phyp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     113542536 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 113542536
NCBI-ProteinID: XP_026795936
LinkDB All DBs
Position
Unknown
AA seq 555 aa AA seqDB search
MGAGFGRILQEENNEPQTVGLAGLQSLSEKHLLRESVMLRTALSRVVPHFSRISACRFSA
AAIPAPSTQPEVHYNKLFINNEWHDAVSKKTFPTINPATGEVICQVAEGDKADVDKAVKA
AKDAFRLGSPWRRMDASQRGLLLHRLADCIERDSAYLAELETLDNGKPYAVAYTVDLPMV
VKCLRYYAGWADKWEGKTIPIDGDYFCYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALAT
GNTVVMKVAEQTPLTALYVASLIKEVGFPPGVVNIIPGMGPTAGAAITSHNDVDKIAFTG
STEVGHLIQQASGTSNLKKVTLELGGKSPNIILSDANMEQAVDQAHMAIFFNQGQCCCAG
SRTYVQESIYDEFVERSVEIAKKRVVGNPFNLQTEHGPQIDNEQYQKILGYIRSGKHEGA
KLMCGGDVASDRGYFIQPTIFGDVQDGMTIAREEIFGPVMQILKFKTIEEVIERANDTKY
GLAAAVFTTDINKAQYISNSLRAGTVWINCYNVFGVQAPFGGYKASGIGREMGEYGLENY
TEVKTVTIKIPQKNS
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgggggcggggtttggtagaatactgcaagaagaaaacaacgagccccagacagttggc
ttggctggtttgcagagtttatctgagaagcacctgttgcgtgaatccgtcatgctccgc
accgcgctctcacgggtcgtcccgcatttctcccgcatctccgcgtgcaggttttccgct
gcagcgattcccgcaccgagcactcagcccgaggttcactacaacaagctcttcatcaac
aatgagtggcatgatgcagtgagcaagaaaacctttccaaccatcaatcctgccactggt
gaagtcatctgccaggttgcagaaggtgataaggccgatgtagataaagcagtgaaggct
gcgaaggatgcattcagactcggctctccatggcggcgcatggacgcatctcagcgtgga
ctccttctgcaccgcctggctgattgcatagagagggactccgcctatctggcagagctg
gaaactctggacaatggaaagccatatgctgtggcctacactgttgatttgcccatggtg
gtcaaatgtttgaggtattatgctggctgggcggacaaatgggagggcaagaccattcca
atcgacggtgattatttctgctatacccggcatgagcctgtcggagtgtgtggccagatt
attccttggaatttccctctcctgatgcaggcatggaaactgggacctgctctggctaca
ggtaacaccgtagtgatgaaggtggcagagcagacgcctctcactgcgctctacgtggcc
agcctgataaaggaggtgggctttcctcctggtgttgtgaatatcatccctggaatgggc
cctacagctggggcagccatcacttctcacaatgatgtggataaaattgccttcactggc
tccactgaggtaggtcacctaattcagcaagcctctggcaccagcaacctaaagaaagta
actctggaactgggaggaaagagccccaacattattctttctgatgccaacatggagcaa
gcagtggaccaggcccacatggccatcttcttcaaccagggtcagtgctgctgcgcaggt
tcacgcacctatgtgcaggaaagcatctatgatgagtttgttgagcgcagcgtggaaata
gcaaagaagagagtggtgggaaatccttttaaccttcaaactgagcatggaccgcagatt
gataatgagcagtaccagaagattctgggctacatacgcagtgggaaacatgagggagca
aagctcatgtgtggaggtgatgtggcatcagaccgcgggtactttatccagcctaccatc
tttggagatgttcaggatggcatgacaattgctcgtgaagagatctttggtccagttatg
caaattctgaagtttaagactatagaagaggtgattgagcgagccaatgacaccaagtat
ggcctggcagctgctgtcttcacgacagatatcaacaaggcacagtacatctcgaacagt
cttcgtgctggcactgtctggattaactgctacaatgtgtttggagttcaggctccgttt
ggtggctataaggcctcagggattggacgtgaaatgggagagtatggcctggaaaactac
actgaagtcaaaaccgtaacaattaagattccgcagaaaaactcgtaa

DBGET integrated database retrieval system