KEGG   Pangasianodon hypophthalmus (striped catfish): 113543665Help
Entry
113543665         CDS       T05759                                 

Gene name
sod1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    113543665 (sod1)
Enzymes [BR:phyp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     113543665 (sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 113543665
NCBI-ProteinID: XP_026797864
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MAMKAVCVLTGTGEVTGTVFFEQQDEGFPVKVTGKITGLSPGLHGFHVHAFGDNTNGCIS
AGPHFNPYNKTHGGPEDENRHVGDLGNVTAGSDGIANISIEDKQVSLTGRHSIIGRTMVI
HEKEDDLGKGNNEESLKTGNAGGRLACGVIGIAP
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggccatgaaagctgtctgcgtcctcacaggcacaggagaagtgactggcacagttttc
tttgagcagcaggatgaaggttttcctgtaaaggttacaggaaagatcactggcctgagc
cctggcctgcatggttttcatgtccatgcctttggagacaacacaaatgggtgcatcagt
gcaggacctcacttcaacccctacaacaagacccatggtgggccagaagatgagaacagg
catgttggagatctgggtaatgtgactgccgggtctgatggaattgctaatatcagcatc
gaggacaaacaggtgtcactgacaggacgtcactcgatcatcgggaggaccatggtgatt
catgagaaggaggatgacttgggcaaaggtaacaatgaggaaagtctcaaaacgggcaat
gcaggaggtcgtctggcttgtggcgtgataggcatcgctccgtga

DBGET integrated database retrieval system