KEGG   Pangasianodon hypophthalmus (striped catfish): 113544629
Entry
113544629         CDS       T05759                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1D-like
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04010  MAPK signaling pathway
phyp04020  Calcium signaling pathway
phyp04260  Cardiac muscle contraction
phyp04261  Adrenergic signaling in cardiomyocytes
phyp04270  Vascular smooth muscle contraction
phyp04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113544629
   04020 Calcium signaling pathway
    113544629
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    113544629
  09153 Circulatory system
   04260 Cardiac muscle contraction
    113544629
   04261 Adrenergic signaling in cardiomyocytes
    113544629
   04270 Vascular smooth muscle contraction
    113544629
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:phyp04040]
    113544629
Ion channels [BR:phyp04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   113544629
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ PKD_channel CAC1F_C
Other DBs
NCBI-GeneID: 113544629
NCBI-ProteinID: XP_026799339
LinkDB
Position
Unknown
AA seq 2044 aa
MYIPEETQENHQGSNYTSPSLVMVSNVSEQEHSVSVSKGGMVGLAPEHIPTPNAALSWQA
AIDAARQAKLIRSAAAAPISTASSTQQQRQHYSKPKKQTSTVATRPPHSLLCLTLKNPLR
RACINIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLEQVEYLFLIIFTVEA
FLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTPIGGKAADFDVK
ALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKM
HRACFIFKNGHRGPIAEEKPAPCAANNAHGRHCTPPNITQCMMGWEGPNDGITNFDNFAF
AMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKE
REKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENDEGLDDAKPRNLSIPASESE
SVNTDIPPTGDLEGEPCCTHLVNRISKSKFSRYSRRWNRLCRRKCRAAVKSNVFYWLVIF
FVFLNTLTIASEHHKQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFD
GFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIA
SLLLLLFLFIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDWNSVMYD
GIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKE
RRKLARMASPEKWQGNEKLPVEKKEEKIEMKSITSNEETPKSTKINIDDNDDNPYPANDF
PGEDDDDEEPDMPVGPRPRPLSDIHLKEKAIPMPEARAFFIFSHTNKFRVLCHRIVNHNI
FTNLILFFILLSSISLAAEDPVKSDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHK
GSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQC
VFVAIRTIGNIVIVTSLLQFMFACIGVQLFKGKFYYCTDSSKQTQTECRGTYILYKDGNV
GKPERAVRNWDNSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDAGPIYNYRVV
ISVFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRR
YIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQSPSFHSAMNILNMLFTGL
FTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINPADPSSSTPSSVVRPMG
SQNTEDNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFI
YAVIGMQMFGKIALRDNSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEK
GSEEAPTSEECGSHFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDE
FKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTV
MFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVG
KFYATFLIQEYFRKFKKRKEQGLVAKVPPKTALSLQAGLRTLHEMGPEIRRAISGDLTAE
EELEKAMKETVCTASEDDLXQRSDGFFRNHMNYYHQSDDCTDFPPSFTTQRPLHISKSGS
PGEGKSPSREKLVDSTFTPSSYSSSGSNANINNANNTSISHCYPSISTVDGHTRPLLIPV
LLPCSSWSFPNKSSDSGECHYPVISPGEAAKDEIHDKMVTENECQHEQDMLPTKMLVLQN
DECKQLAVVEETDGGGDRRPWQFPQQTVLCPTALSRRSSFHLECLGRQSRTETSHKTALP
QHFVQHQVIHIPKVLISEQLDHYSQDPSFVKVAKQELAATHDMTMEAMETVSESVLNANG
PHSPNSNLLPNMHCSNGVRTSQGQNRAWEIKVLEKGVGGLQVAEQDQLNSKLLVDEDMEC
VTSL
NT seq 6135 nt   +upstreamnt  +downstreamnt
atgtacataccggaggaaacccaggaaaaccatcaaggttctaactacaccagcccatct
ctggttatggtgtctaatgtgagtgagcaggagcacagtgttagtgttagcaaaggtggc
atggtaggtctggcaccagaacacatcccaacaccaaatgccgccctcagctggcaggca
gctatcgatgcagcacgtcaggccaagctgataaggagtgcagcagcagcacccatctcc
acagcaagttctacgcagcaacagcgtcagcactacagcaagcccaagaaacagacgagc
acagtggccacgcggcccccgcactccctcctctgccttaccctcaaaaaccccctccga
cgagcctgtatcaacatcgtggagtggaaaccctttgaaatcatcattttaatgactatt
tttgctaactgtgttgccttagctgtctacattcccttccctgaggatgactccaatgcc
accaactccaatctggagcaagtggaatatctcttccttatcatctttacagtggaagca
tttctgaaggtcatcgcatatgggctgctatgtcaccccaatgcctatttaaggaatggc
tggaatctgttggatttcatcattgtggttgtagggttgttcagtgctatattagaacag
gccacaaaaggagatggagggacacctatcggagggaaggcagcagactttgatgtgaaa
gccctgcgtgcttttagagtactgagacccctacgattggtgtccggcgttcccagttta
caagtagtgttgaactccataattaaggccatggttcctctgctgcacattgctctgctt
gtactctttgtgatcatcatctatgccatcatcggcctagagctcttcatggggaagatg
caccgcgcatgctttatcttcaaaaatggacacagagggcctatagctgaggagaagcct
gcaccttgtgccgcaaataatgcccatgggcggcactgcaccccacccaacatcactcag
tgcatgatgggatgggagggaccaaatgatggcattacaaactttgataactttgcgttc
gccatgctgacagtgtttcagtgcatcactatggagggctggactgacgtcctctattgg
atgcaggatgctatgggctatgagcttccctgggtctattttgtcagtctcgtcatcttt
ggatcctttttcgttctaaatctggttcttggggtattgagtggagagttctctaaggaa
cgtgaaaaggcaaaggcacgtggagatttccagaagttacgagaaaagcaacaacttgaa
gaagatcttaagggctacctggattggatcactcaggctgaggacattgacccagagaat
gatgagggactggatgatgccaaacccagaaacttgagcattccagcaagtgagagtgag
tccgtgaacaccgatatccctcccactggagatttagagggagaaccctgctgtacccac
ctagtaaataggatctccaaatccaaattcagtcgatattctcgtcgctggaatcgtctg
tgccggcgtaaatgtcgggctgctgtgaagtcgaatgtcttttattggctggttattttt
tttgtgttcctgaatactctaaccattgcctcggaacaccataaacaaccacaatggctg
actgatgtacaagatatcgccaacaaggttctcctagctctcttcactggagaaatgctt
ttgaagatgtacagtttgggactgcaggcgtattttgtctcactttttaatcgctttgat
ggttttgtggtgtgtggtgggatactagagaccatcctggtggagacgaagattatgtcc
cctctaggcatctcagtgctgcgttgtgtacgcctgctgcgcatcttcaaaatcaccagg
tactggaactctctcagcaacctggtagcatctttgctgaactctgtgcgctccatcgcc
tccctgctgctgctactcttccttttcatcattatttttagtttgcttggcatgcaactg
tttggtgggaaattcaacttcgatgagacacgtcggagcacatttgacaacttcccccag
tcattactcacagtcttccagattttgactggagaggactggaactcagtaatgtatgat
gggattatggcctatggtggaccatcatttcctggcatgcttgtgtgcatctacttcatc
attctcttcatttgtggaaactacatcctcctgaatgtattcttggccattgctgtagac
aaccttgcagatgcagagagtctgacatcagctcaaaaagaggaagaagaagagaaggag
aggcggaagctggccagaatggctagtccggagaagtggcaaggcaatgagaaacttcca
gttgagaaaaaagaggaaaagattgaaatgaaatcaattacctcaaatgaagaaactcca
aaatccaccaagatcaatattgatgacaacgatgacaatccatatccagcgaatgacttc
ccaggagaggatgatgatgatgaggagccagacatgccagtgggtccgaggccaaggccg
ctttcagacatacacctgaaggagaaagctattcctatgcctgaagctagagccttcttc
atcttcagtcatacaaacaagtttcgagttttgtgtcataggatcgtcaaccacaacatc
ttcaccaatcttatcctcttctttattctgctgagtagtatttctctggctgcagaggac
ccagtaaaaagtgactcattcaggaatcagattctaggttatgcagatcatgttttcacg
ggtctcttcaccatagagatcattttaaagatgacagcatacggagcattcctccataag
ggttctttctgtcgtaactacttcaacattctggatctggtggtggtcagtgtctctctc
atctcttctgggattcagtcgagtgccattaacgttgtgaagattttgagagttcttaga
gtcctcaggcccctgagagccattaacagagccaagggtctcaaacatgtagtgcagtgt
gtatttgtagcaatccgcaccatcgggaatattgttattgtcaccagtctgctgcagttt
atgttcgcttgcattggagtgcaactctttaagggcaagttctactattgcacagactct
tctaagcagacccagacagaatgcagggggacttatattctgtataaagatggtaatgtt
gggaagccggaaagagctgttcgtaactgggacaacagtgacttcaactttgatgatgtt
cttcaaggcatgatggccttgtttgctgtgtccacttttgaaggatggcctggcctcctg
tacagagccatagactcccatgcagaagatgctggccccatctacaactaccgtgtggtc
atctctgtcttctttatcatctatatcatcatcatcgccttcttcatgatgaacatcttt
gtcggttttgtcattgttacattccaggagcaaggagagcaggagtacaagaactgcgag
ctggacaagaaccagcggcagtgtgtggagtatgctctaaaggcacggcctctacgcagg
tacattccaaagaatccataccagtataaggtgtggtatgtggtcaactccacctacttt
gagtatctgatgttcactctaatcctactcaacaccatctgcttggcaatgcagcaccat
ggtcagtcaccatccttccacagtgccatgaacatcctcaacatgctcttcactggtctg
ttcactgtggagatgatcctcaaacttatagccttcaaacccaggggttactttagtgat
ccttggaatgtttttgacttcctcatcgtaattggcagcattatagacgtcattctgagt
gaaataaatccagctgacccttcttcctctactccttcctctgtggtaagaccaatgggg
tcccagaatacagaagataatgccaggatttccattaccttctttcgactctttcgagtt
atgagactggtaaagctgctttcacgtggagagggaattcggaccttgctgtggaccttt
atcaaatctttccaagcacttccttatgtagcattgctcatagtaatgcttttcttcatc
tacgctgttattggaatgcagatgtttggtaaaatagcactgagagacaatagccagatc
aaccgaaacaacaattttcagacgtttccgcaggctgtgctgctgcttttcagatgtgca
acaggtgaggcctggcaggagataatgctggcttgctcccctaaccgcccatgtgaaaag
ggttctgaagaggcccctaccagtgaggagtgtggcagtcattttgccatcatttacttt
gtcagtttctacatgctctgtgcctttctgattatcaacctgtttgtggctgttataatg
gacaactttgactacctgacacgggattggtccatactaggaccacatcatctcgatgag
ttcaagaggatatgggcagagtatgaccctgaggcaaagggaaggattaagcatctggat
gtggtgacattgcttagaagaattcagccacccctggggtttggcaaactctgtccccac
agggtggcctgcaagcgactggtatccatgaacatgcctctgaacagtgacggcacagta
atgtttaatgctactctgtttgccctcgtgcgcaccgcccttcgcattaaaactgaaggt
aatctggagcaggcaaatgaagaactgagggcaataataaaaaaaatctggaagaggacc
agtatgaagttgctggaccaggttgtgcccccagcaggagatgatgaggtgacggttggg
aagttctatgccacattcctcatccaggaatacttcaggaagttcaaaaagcggaaagag
cagggtttagtggctaaagtgcctccaaaaacagctctctctctgcaggctggtctgcgc
acactgcatgaaatgggtccagaaatccggagggcaatatcaggagacctcactgcagag
gaagagctggagaaggccatgaaggaaacagtgtgtactgcatctgaagatgatctcnca
cagcgatcagatggtttctttagaaaccacatgaactattatcatcagagtgatgactgc
actgatttccccccatccttcaccactcagcggccactgcacatcagcaagtcaggcagc
cctggagagggcaagtcaccgtctcgtgagaaactggtggactccaccttcacaccaagc
agctattcctcctcaggttccaatgccaacatcaacaatgccaacaacacatccatcagc
cactgctacccgtccattagcacagtggatgggcacaccaggcccctgctcatacctgta
ctactcccgtgctcttcatggtccttccctaataaaagctcagactcgggtgaatgtcat
tacccagtaatttccccaggagaggcagctaaagatgaaatacatgacaagatggttaca
gagaatgaatgccaacatgaacaggacatgctccccactaaaatgttggtgttgcagaat
gacgagtgtaagcagttagctgtggtggaagagacagacgggggtggggacagaagacca
tggcagtttccccaacaaactgttctctgtccaactgcactaagtcgacgatcttccttt
catctagagtgtctgggcagacagagcagaactgaaacttcacataagacagctttgcct
cagcactttgtccagcatcaggtgatacacataccaaaagtgttgatatcagaacagttg
gaccactactcacaggacccctcattcgtcaaggtggccaagcaggagctggctgctaca
catgacatgaccatggaggcgatggaaactgtatcagaaagcgtactcaatgccaatggg
cctcacagcccaaacagcaacctcctgcccaatatgcactgcagcaatggagtgagaacc
agccagggacaaaatagagcctgggaaataaaggttcttgagaagggagttggaggactg
caggttgctgagcaagatcaactgaacagtaagctactagttgatgaagacatggagtgt
gtgacaagcttgtag

DBGET integrated database retrieval system